Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R345

Protein Details
Accession A0A372R345    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-30NFQVYRTRISQKKKRQWSAKEKLMVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, mito_nucl 13.833, mito 9.5, cyto_nucl 9.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007889  HTH_Psq  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF04218  CENP-B_N  
Amino Acid Sequences MVRGNFQVYRTRISQKKKRQWSAKEKLMVIAYYEQGHSKRSIANKYEIELKQLQKWLKNKDQLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.64
3 0.72
4 0.78
5 0.85
6 0.86
7 0.89
8 0.9
9 0.89
10 0.86
11 0.81
12 0.7
13 0.63
14 0.54
15 0.43
16 0.33
17 0.25
18 0.18
19 0.13
20 0.13
21 0.12
22 0.11
23 0.12
24 0.12
25 0.12
26 0.15
27 0.2
28 0.27
29 0.28
30 0.35
31 0.34
32 0.35
33 0.43
34 0.4
35 0.39
36 0.38
37 0.38
38 0.36
39 0.41
40 0.44
41 0.42
42 0.49
43 0.53
44 0.57