Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RV82

Protein Details
Accession A0A372RV82    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-102AKVMSSKRKTKHRGPFSSNTCFNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 7extr 7, E.R. 6, mito 4, golg 3
Family & Domain DBs
Amino Acid Sequences MKLFIPLTIVAIICIIALEQIEAFNTTLGIFVFFTQCKVWATDNFGNTVMDTGWLNCENGDPDPTYHIREITANPYWLHAKVMSSKRKTKHRGPFSSNTCFNFGGNVFKWHFDQYDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.07
11 0.06
12 0.06
13 0.06
14 0.06
15 0.06
16 0.07
17 0.06
18 0.06
19 0.09
20 0.09
21 0.1
22 0.1
23 0.12
24 0.12
25 0.14
26 0.15
27 0.15
28 0.23
29 0.26
30 0.26
31 0.26
32 0.26
33 0.23
34 0.21
35 0.19
36 0.11
37 0.08
38 0.07
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.08
49 0.07
50 0.11
51 0.12
52 0.14
53 0.14
54 0.13
55 0.13
56 0.14
57 0.15
58 0.17
59 0.18
60 0.18
61 0.17
62 0.19
63 0.2
64 0.19
65 0.19
66 0.14
67 0.14
68 0.2
69 0.29
70 0.36
71 0.42
72 0.49
73 0.55
74 0.64
75 0.7
76 0.72
77 0.74
78 0.76
79 0.79
80 0.8
81 0.83
82 0.8
83 0.81
84 0.77
85 0.68
86 0.62
87 0.53
88 0.44
89 0.38
90 0.31
91 0.29
92 0.26
93 0.29
94 0.26
95 0.28
96 0.3
97 0.3