Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q2U2

Protein Details
Accession A0A372Q2U2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
29-54LENVSNRIRRIRQKHKVQSNVNNTFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.333, mito_nucl 12.499, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSXEDYMKLKNNPPPCYFTKKAIRRYEMWLENVSNRIRRIRQKHKVQSNVNNTFLTASPFPRKPVQFQRYYSQRESWMDKPRSLTPPPLPPKPIELMGGLERYPMQRSASAPEIRNLWNDRSNMHNIYSRTALGNLAEAYFDSVREVDLISFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.61
3 0.57
4 0.59
5 0.61
6 0.63
7 0.69
8 0.72
9 0.71
10 0.65
11 0.69
12 0.7
13 0.64
14 0.59
15 0.52
16 0.45
17 0.42
18 0.44
19 0.4
20 0.34
21 0.31
22 0.35
23 0.38
24 0.45
25 0.53
26 0.59
27 0.66
28 0.73
29 0.81
30 0.84
31 0.87
32 0.86
33 0.86
34 0.85
35 0.8
36 0.72
37 0.62
38 0.52
39 0.44
40 0.35
41 0.29
42 0.19
43 0.17
44 0.2
45 0.21
46 0.24
47 0.29
48 0.3
49 0.33
50 0.43
51 0.46
52 0.47
53 0.5
54 0.55
55 0.56
56 0.61
57 0.56
58 0.48
59 0.44
60 0.4
61 0.42
62 0.41
63 0.43
64 0.39
65 0.38
66 0.39
67 0.4
68 0.42
69 0.39
70 0.38
71 0.32
72 0.4
73 0.43
74 0.44
75 0.41
76 0.37
77 0.39
78 0.36
79 0.33
80 0.24
81 0.19
82 0.18
83 0.18
84 0.18
85 0.15
86 0.13
87 0.12
88 0.12
89 0.13
90 0.12
91 0.12
92 0.13
93 0.14
94 0.19
95 0.25
96 0.29
97 0.29
98 0.29
99 0.31
100 0.3
101 0.34
102 0.32
103 0.3
104 0.3
105 0.3
106 0.29
107 0.31
108 0.36
109 0.33
110 0.32
111 0.33
112 0.29
113 0.32
114 0.32
115 0.28
116 0.24
117 0.23
118 0.21
119 0.15
120 0.17
121 0.14
122 0.12
123 0.11
124 0.1
125 0.13
126 0.12
127 0.12
128 0.11
129 0.11
130 0.11
131 0.11
132 0.12