Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RR19

Protein Details
Accession A0A372RR19    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
56-78LMSACCVCRRKRVKNNENGNDPVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 7, mito 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIYNMRLFILFLLNFIATTAFPINITSNHLRKRNILDDKFVLTILKWAIIFVVVFLMSACCVCRRKRVKNNENGNDPVNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.06
5 0.09
6 0.09
7 0.08
8 0.08
9 0.09
10 0.1
11 0.1
12 0.16
13 0.19
14 0.24
15 0.31
16 0.35
17 0.35
18 0.37
19 0.43
20 0.47
21 0.51
22 0.46
23 0.44
24 0.41
25 0.41
26 0.38
27 0.32
28 0.23
29 0.13
30 0.14
31 0.1
32 0.09
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.1
48 0.14
49 0.16
50 0.27
51 0.37
52 0.48
53 0.58
54 0.69
55 0.75
56 0.81
57 0.9
58 0.89
59 0.86
60 0.79