Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QT26

Protein Details
Accession A0A372QT26    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-42FLFFSFLKKKKKFKQKSGAINCLYHydrophilic
NLS Segment(s)
PositionSequence
26-33KKKKKFKQ
Subcellular Location(s) mito 8, plas 5, E.R. 5, pero 3, golg 3, nucl 1, cyto 1, extr 1, cyto_nucl 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYINMRFQFNFYSFCIKFFLFFSFLKKKKKFKQKSGAINCLYLVPFVTSISLYYVIFFNQCLLYLMIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.25
4 0.24
5 0.22
6 0.23
7 0.18
8 0.18
9 0.24
10 0.31
11 0.37
12 0.46
13 0.52
14 0.58
15 0.64
16 0.75
17 0.78
18 0.79
19 0.83
20 0.82
21 0.86
22 0.85
23 0.84
24 0.74
25 0.64
26 0.54
27 0.44
28 0.35
29 0.24
30 0.16
31 0.09
32 0.07
33 0.07
34 0.07
35 0.06
36 0.07
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.1
44 0.1
45 0.1
46 0.09
47 0.09
48 0.11