Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R5U9

Protein Details
Accession A0A372R5U9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGKILKQKSIRSRKPSKSGRRIPNAWIHydrophilic
NLS Segment(s)
PositionSequence
7-21QKSIRSRKPSKSGRR
Subcellular Location(s) mito 14.5, mito_nucl 13.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MGKILKQKSIRSRKPSKSGRRIPNAWIIFSNEFYNKHYRTGKTKRTIVMKSAKFAWNSMSAQEKVLYYYQYEQLRKSKLNCNPCNEIIFVLNAKGDDLVLNKNGDDLALNANGDDLVLNENEDDQYNKFFDEVINPEMVQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.89
3 0.89
4 0.89
5 0.9
6 0.9
7 0.89
8 0.83
9 0.77
10 0.76
11 0.67
12 0.58
13 0.49
14 0.44
15 0.36
16 0.34
17 0.32
18 0.24
19 0.24
20 0.25
21 0.31
22 0.27
23 0.32
24 0.36
25 0.37
26 0.45
27 0.54
28 0.6
29 0.61
30 0.65
31 0.64
32 0.66
33 0.64
34 0.61
35 0.61
36 0.53
37 0.47
38 0.46
39 0.44
40 0.37
41 0.34
42 0.3
43 0.24
44 0.23
45 0.22
46 0.22
47 0.19
48 0.19
49 0.2
50 0.17
51 0.14
52 0.15
53 0.13
54 0.1
55 0.11
56 0.16
57 0.2
58 0.21
59 0.22
60 0.26
61 0.29
62 0.31
63 0.33
64 0.36
65 0.38
66 0.48
67 0.5
68 0.51
69 0.53
70 0.52
71 0.49
72 0.41
73 0.35
74 0.25
75 0.21
76 0.16
77 0.11
78 0.1
79 0.08
80 0.08
81 0.07
82 0.06
83 0.06
84 0.07
85 0.09
86 0.1
87 0.11
88 0.1
89 0.11
90 0.11
91 0.1
92 0.09
93 0.08
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.09
100 0.08
101 0.07
102 0.05
103 0.05
104 0.06
105 0.06
106 0.06
107 0.07
108 0.08
109 0.09
110 0.1
111 0.1
112 0.13
113 0.14
114 0.14
115 0.14
116 0.13
117 0.13
118 0.17
119 0.2
120 0.2
121 0.21