Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q021

Protein Details
Accession A0A372Q021   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
174-196ILLSRAQREKRLRKKAVELKTEEHydrophilic
NLS Segment(s)
PositionSequence
183-187KRLRK
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences AILGKKFSQIGIDRARSRDNGVRVYQYILDRFKIIVKLRESGLGGIEEFSDTPIEDTPQPDVSHNETGNIPIFNIPETISQKITLPQPEENLPPRGKKANKQDDSTQDLFDYVTGEAPVALTSGTSETFKTPKPVIDSSESNEPICEVVNTLPKETTSKLPDSSKPINEVSSAILLSRAQREKRLRKKAVELKTEEDPKEYMDMKVWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.46
4 0.48
5 0.48
6 0.44
7 0.43
8 0.42
9 0.43
10 0.4
11 0.42
12 0.4
13 0.36
14 0.36
15 0.32
16 0.3
17 0.27
18 0.26
19 0.27
20 0.29
21 0.3
22 0.32
23 0.32
24 0.33
25 0.33
26 0.36
27 0.33
28 0.27
29 0.24
30 0.18
31 0.15
32 0.13
33 0.12
34 0.09
35 0.08
36 0.08
37 0.07
38 0.06
39 0.07
40 0.07
41 0.09
42 0.1
43 0.11
44 0.13
45 0.16
46 0.16
47 0.17
48 0.19
49 0.22
50 0.26
51 0.25
52 0.24
53 0.21
54 0.22
55 0.22
56 0.19
57 0.15
58 0.11
59 0.11
60 0.1
61 0.1
62 0.09
63 0.12
64 0.15
65 0.16
66 0.16
67 0.16
68 0.16
69 0.19
70 0.21
71 0.19
72 0.2
73 0.19
74 0.2
75 0.22
76 0.25
77 0.25
78 0.27
79 0.26
80 0.25
81 0.26
82 0.32
83 0.33
84 0.36
85 0.44
86 0.5
87 0.52
88 0.54
89 0.57
90 0.54
91 0.58
92 0.52
93 0.41
94 0.3
95 0.26
96 0.23
97 0.18
98 0.14
99 0.06
100 0.06
101 0.05
102 0.05
103 0.05
104 0.05
105 0.05
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.05
112 0.05
113 0.06
114 0.08
115 0.1
116 0.11
117 0.15
118 0.16
119 0.18
120 0.23
121 0.24
122 0.26
123 0.29
124 0.3
125 0.29
126 0.36
127 0.34
128 0.29
129 0.27
130 0.23
131 0.19
132 0.17
133 0.14
134 0.07
135 0.09
136 0.16
137 0.17
138 0.18
139 0.18
140 0.18
141 0.21
142 0.22
143 0.26
144 0.23
145 0.26
146 0.29
147 0.33
148 0.37
149 0.42
150 0.46
151 0.43
152 0.42
153 0.4
154 0.37
155 0.34
156 0.3
157 0.24
158 0.19
159 0.16
160 0.12
161 0.12
162 0.12
163 0.14
164 0.2
165 0.26
166 0.26
167 0.35
168 0.46
169 0.56
170 0.66
171 0.75
172 0.75
173 0.75
174 0.84
175 0.85
176 0.84
177 0.82
178 0.77
179 0.7
180 0.71
181 0.72
182 0.62
183 0.55
184 0.45
185 0.38
186 0.38
187 0.35
188 0.27