Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QRS7

Protein Details
Accession A0A372QRS7    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
30-49EFFDKLQRKHTQRVRNRVAHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14cyto_nucl 14, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
CDD cd00303  retropepsin_like  
Amino Acid Sequences MVFIKTLVEEKYEVAALVDTTSRFSTISEEFFDKLQRKHTQRVRNRVAHVSKLVKRYNKDAVGEISDLRLRFINKGNYLTVDSVEDTNFIIVKSSKYPLVLGQSWLKEHEVEISIKWDKISMDGIIISIIYEEALHSKEIYKVDNSEDPYMLGIYEKETLSIGDCPRTQSSESSESSESSGDEFSILKKKGENNEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.1
4 0.1
5 0.11
6 0.09
7 0.11
8 0.12
9 0.12
10 0.11
11 0.11
12 0.14
13 0.15
14 0.18
15 0.19
16 0.2
17 0.21
18 0.22
19 0.27
20 0.28
21 0.28
22 0.34
23 0.4
24 0.43
25 0.53
26 0.61
27 0.65
28 0.7
29 0.79
30 0.8
31 0.78
32 0.77
33 0.77
34 0.72
35 0.66
36 0.63
37 0.6
38 0.56
39 0.56
40 0.58
41 0.54
42 0.52
43 0.53
44 0.55
45 0.51
46 0.47
47 0.42
48 0.38
49 0.35
50 0.33
51 0.27
52 0.2
53 0.18
54 0.17
55 0.15
56 0.15
57 0.13
58 0.14
59 0.2
60 0.24
61 0.25
62 0.27
63 0.27
64 0.26
65 0.27
66 0.25
67 0.2
68 0.14
69 0.12
70 0.11
71 0.1
72 0.09
73 0.07
74 0.07
75 0.07
76 0.05
77 0.06
78 0.06
79 0.07
80 0.08
81 0.1
82 0.1
83 0.1
84 0.11
85 0.11
86 0.15
87 0.15
88 0.15
89 0.17
90 0.17
91 0.17
92 0.18
93 0.17
94 0.13
95 0.12
96 0.12
97 0.11
98 0.11
99 0.1
100 0.14
101 0.15
102 0.15
103 0.14
104 0.13
105 0.11
106 0.12
107 0.13
108 0.09
109 0.08
110 0.08
111 0.08
112 0.07
113 0.07
114 0.05
115 0.04
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.05
122 0.06
123 0.06
124 0.08
125 0.11
126 0.13
127 0.15
128 0.15
129 0.16
130 0.19
131 0.24
132 0.26
133 0.25
134 0.24
135 0.22
136 0.21
137 0.19
138 0.15
139 0.11
140 0.08
141 0.08
142 0.1
143 0.1
144 0.1
145 0.1
146 0.1
147 0.12
148 0.16
149 0.16
150 0.19
151 0.2
152 0.23
153 0.25
154 0.28
155 0.28
156 0.26
157 0.31
158 0.32
159 0.33
160 0.33
161 0.33
162 0.3
163 0.3
164 0.27
165 0.21
166 0.16
167 0.15
168 0.1
169 0.1
170 0.1
171 0.12
172 0.2
173 0.21
174 0.21
175 0.25
176 0.32