Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RHJ1

Protein Details
Accession A0A372RHJ1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MFKKKKTKKEVHVFPRDLKELBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.833, nucl 11.5, cyto 9, cyto_mito 7.499, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019154  Arb2_domain  
Pfam View protein in Pfam  
PF09757  Arb2  
Amino Acid Sequences MFKKKKTKKEVHVFPRDLKELGYCIDEEGQLKTIVGGEPYKFEVREKDKAYNEALYDALLETIGDWVQDTLQKKFGMVRALLPIGVTESDVHTKIYVSPDYLTNEKMMIFIPGTSHTIGIWSRRVLADKSVVEGSMIAYTQRAIEMGFSVVITNPNEVFWYKDKGVLILPKSTSEFSTIPGSESPENHIKYVFENFVIPSAAQKIVIVANSYGGHCAIDIVQNKFDALKDRVKAIEFTASTHSIDYVTTDKMRVWVREHCRNWLMSDQEAGKEVIDVRFGCTSLSSGAELNEFVTTEVIDDVFSFIERRVVNEEFWEISDNEENEDEYFEKTKIIELDNELMNEIGDIKEIRDIQEKVRSELEESADSEWLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.74
4 0.63
5 0.53
6 0.45
7 0.36
8 0.32
9 0.26
10 0.19
11 0.17
12 0.18
13 0.19
14 0.17
15 0.17
16 0.18
17 0.16
18 0.16
19 0.14
20 0.14
21 0.13
22 0.14
23 0.15
24 0.14
25 0.16
26 0.2
27 0.23
28 0.22
29 0.23
30 0.3
31 0.34
32 0.42
33 0.45
34 0.49
35 0.5
36 0.53
37 0.55
38 0.49
39 0.43
40 0.36
41 0.31
42 0.22
43 0.19
44 0.15
45 0.11
46 0.07
47 0.06
48 0.05
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.06
55 0.11
56 0.13
57 0.15
58 0.2
59 0.2
60 0.2
61 0.24
62 0.26
63 0.28
64 0.26
65 0.26
66 0.26
67 0.27
68 0.26
69 0.22
70 0.18
71 0.14
72 0.13
73 0.11
74 0.07
75 0.09
76 0.12
77 0.12
78 0.13
79 0.12
80 0.12
81 0.14
82 0.18
83 0.16
84 0.15
85 0.16
86 0.19
87 0.22
88 0.23
89 0.21
90 0.18
91 0.17
92 0.16
93 0.15
94 0.12
95 0.1
96 0.09
97 0.08
98 0.08
99 0.1
100 0.12
101 0.11
102 0.11
103 0.1
104 0.12
105 0.13
106 0.14
107 0.15
108 0.14
109 0.15
110 0.16
111 0.19
112 0.18
113 0.19
114 0.22
115 0.2
116 0.22
117 0.21
118 0.19
119 0.17
120 0.16
121 0.13
122 0.08
123 0.08
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.04
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.08
139 0.08
140 0.08
141 0.08
142 0.08
143 0.09
144 0.09
145 0.11
146 0.11
147 0.16
148 0.15
149 0.18
150 0.18
151 0.18
152 0.2
153 0.22
154 0.21
155 0.19
156 0.19
157 0.17
158 0.19
159 0.18
160 0.17
161 0.16
162 0.15
163 0.14
164 0.17
165 0.16
166 0.16
167 0.15
168 0.17
169 0.15
170 0.15
171 0.17
172 0.2
173 0.2
174 0.2
175 0.2
176 0.17
177 0.18
178 0.2
179 0.17
180 0.11
181 0.1
182 0.1
183 0.11
184 0.11
185 0.09
186 0.07
187 0.09
188 0.08
189 0.08
190 0.07
191 0.07
192 0.08
193 0.08
194 0.08
195 0.06
196 0.08
197 0.09
198 0.09
199 0.08
200 0.07
201 0.07
202 0.06
203 0.06
204 0.05
205 0.09
206 0.13
207 0.14
208 0.15
209 0.15
210 0.15
211 0.15
212 0.16
213 0.16
214 0.17
215 0.21
216 0.21
217 0.23
218 0.25
219 0.25
220 0.25
221 0.21
222 0.23
223 0.18
224 0.19
225 0.21
226 0.2
227 0.2
228 0.19
229 0.18
230 0.12
231 0.12
232 0.12
233 0.1
234 0.11
235 0.11
236 0.11
237 0.12
238 0.16
239 0.2
240 0.21
241 0.22
242 0.29
243 0.37
244 0.46
245 0.48
246 0.49
247 0.49
248 0.47
249 0.46
250 0.42
251 0.37
252 0.28
253 0.29
254 0.24
255 0.22
256 0.23
257 0.2
258 0.15
259 0.13
260 0.14
261 0.11
262 0.13
263 0.12
264 0.13
265 0.14
266 0.14
267 0.13
268 0.12
269 0.12
270 0.1
271 0.11
272 0.1
273 0.09
274 0.1
275 0.1
276 0.1
277 0.1
278 0.09
279 0.08
280 0.07
281 0.07
282 0.06
283 0.06
284 0.06
285 0.06
286 0.05
287 0.05
288 0.06
289 0.06
290 0.06
291 0.07
292 0.07
293 0.12
294 0.12
295 0.14
296 0.19
297 0.21
298 0.21
299 0.23
300 0.25
301 0.2
302 0.21
303 0.22
304 0.16
305 0.18
306 0.22
307 0.2
308 0.2
309 0.19
310 0.19
311 0.16
312 0.19
313 0.16
314 0.14
315 0.16
316 0.14
317 0.15
318 0.14
319 0.17
320 0.18
321 0.2
322 0.21
323 0.23
324 0.27
325 0.28
326 0.28
327 0.25
328 0.22
329 0.19
330 0.16
331 0.13
332 0.08
333 0.08
334 0.08
335 0.08
336 0.13
337 0.14
338 0.17
339 0.24
340 0.26
341 0.3
342 0.39
343 0.4
344 0.39
345 0.43
346 0.41
347 0.37
348 0.4
349 0.38
350 0.32
351 0.32
352 0.3