Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R5V1

Protein Details
Accession A0A372R5V1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
102-132YLKQHGKKRPVEHMKQGNKKCKRSKIDSNMLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039355  Transcription_factor_GATA  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MSQINDEQQQEIVYEEWMYDLTVVDFVIAGLIPIDKAVSLIKQWELEDKISASTNYHPKIFEIFTNPNISARNACVNCNITKSPAWRRDDHGRLLCNACGLYLKQHGKKRPVEHMKQGNKKCKRSKIDSNML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.08
3 0.08
4 0.08
5 0.08
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.05
12 0.05
13 0.05
14 0.05
15 0.04
16 0.03
17 0.03
18 0.03
19 0.03
20 0.03
21 0.04
22 0.03
23 0.04
24 0.05
25 0.05
26 0.06
27 0.08
28 0.09
29 0.11
30 0.11
31 0.15
32 0.17
33 0.17
34 0.17
35 0.16
36 0.16
37 0.15
38 0.15
39 0.12
40 0.15
41 0.21
42 0.21
43 0.22
44 0.21
45 0.2
46 0.23
47 0.22
48 0.19
49 0.18
50 0.18
51 0.19
52 0.22
53 0.21
54 0.2
55 0.2
56 0.19
57 0.14
58 0.13
59 0.19
60 0.17
61 0.18
62 0.2
63 0.22
64 0.22
65 0.24
66 0.24
67 0.19
68 0.21
69 0.26
70 0.32
71 0.37
72 0.41
73 0.39
74 0.45
75 0.53
76 0.55
77 0.58
78 0.54
79 0.48
80 0.47
81 0.47
82 0.41
83 0.32
84 0.27
85 0.19
86 0.15
87 0.14
88 0.15
89 0.21
90 0.28
91 0.35
92 0.42
93 0.5
94 0.56
95 0.64
96 0.66
97 0.69
98 0.72
99 0.72
100 0.75
101 0.78
102 0.8
103 0.83
104 0.86
105 0.85
106 0.84
107 0.87
108 0.87
109 0.86
110 0.85
111 0.84
112 0.86