Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QVP3

Protein Details
Accession A0A372QVP3   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
199-243VPDVPDKKKRFLKPCPMCRWGKKRMKLKKIARFRKIRPKFRKIRSBasic
NLS Segment(s)
PositionSequence
217-243RWGKKRMKLKKIARFRKIRPKFRKIRS
Subcellular Location(s) nucl 20.5, mito_nucl 13.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MGEKVNRRVYRTLQESSSLSSVWRPGEVGRTTLLSADSDNNYMGRSSPPLDESRNENENEVIQRNEASRPERISFPNANFLGKQNYDDGTECAGSPINSKYNCINERRKDCEIYVRDISPQRNSDRNNNERNAVQEQRINSNIESGKYSDSTMVLLECCPNKGGIERLQLSLGKLCRVGTFTGNARTEEKPKTSCHFVVPDVPDKKKRFLKPCPMCRWGKKRMKLKKIARFRKIRPKFRKIRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.45
4 0.39
5 0.3
6 0.24
7 0.21
8 0.23
9 0.2
10 0.19
11 0.16
12 0.16
13 0.24
14 0.24
15 0.23
16 0.21
17 0.22
18 0.21
19 0.21
20 0.21
21 0.13
22 0.13
23 0.16
24 0.16
25 0.15
26 0.16
27 0.15
28 0.14
29 0.14
30 0.14
31 0.11
32 0.13
33 0.14
34 0.15
35 0.18
36 0.21
37 0.24
38 0.25
39 0.29
40 0.33
41 0.35
42 0.33
43 0.31
44 0.28
45 0.29
46 0.3
47 0.27
48 0.21
49 0.17
50 0.18
51 0.18
52 0.21
53 0.21
54 0.21
55 0.22
56 0.26
57 0.27
58 0.3
59 0.31
60 0.35
61 0.35
62 0.34
63 0.39
64 0.35
65 0.35
66 0.31
67 0.31
68 0.3
69 0.25
70 0.24
71 0.18
72 0.18
73 0.18
74 0.18
75 0.17
76 0.14
77 0.14
78 0.12
79 0.11
80 0.11
81 0.09
82 0.1
83 0.12
84 0.15
85 0.15
86 0.17
87 0.19
88 0.26
89 0.3
90 0.35
91 0.41
92 0.44
93 0.51
94 0.56
95 0.56
96 0.51
97 0.47
98 0.49
99 0.43
100 0.4
101 0.36
102 0.3
103 0.3
104 0.32
105 0.33
106 0.28
107 0.29
108 0.26
109 0.3
110 0.32
111 0.38
112 0.43
113 0.49
114 0.51
115 0.49
116 0.47
117 0.42
118 0.43
119 0.4
120 0.33
121 0.27
122 0.23
123 0.23
124 0.25
125 0.26
126 0.24
127 0.19
128 0.21
129 0.21
130 0.19
131 0.19
132 0.17
133 0.16
134 0.15
135 0.16
136 0.11
137 0.1
138 0.1
139 0.09
140 0.08
141 0.07
142 0.07
143 0.09
144 0.09
145 0.09
146 0.09
147 0.09
148 0.09
149 0.11
150 0.15
151 0.17
152 0.23
153 0.24
154 0.25
155 0.27
156 0.27
157 0.26
158 0.26
159 0.23
160 0.17
161 0.16
162 0.16
163 0.15
164 0.16
165 0.17
166 0.14
167 0.17
168 0.19
169 0.26
170 0.27
171 0.28
172 0.3
173 0.31
174 0.35
175 0.36
176 0.37
177 0.33
178 0.36
179 0.4
180 0.43
181 0.42
182 0.41
183 0.4
184 0.37
185 0.41
186 0.41
187 0.46
188 0.45
189 0.49
190 0.53
191 0.53
192 0.6
193 0.62
194 0.66
195 0.67
196 0.71
197 0.77
198 0.79
199 0.86
200 0.86
201 0.85
202 0.84
203 0.85
204 0.83
205 0.83
206 0.82
207 0.81
208 0.83
209 0.86
210 0.88
211 0.88
212 0.9
213 0.89
214 0.9
215 0.92
216 0.91
217 0.91
218 0.9
219 0.91
220 0.91
221 0.91
222 0.91
223 0.91