Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RNX5

Protein Details
Accession A0A372RNX5    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-31IQVTKGQHSYKKRKRTSECLTYIHydrophilic
44-70NQNKINPKLTYKKRRLWSNKTETTYKKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences PSHIVSAIIQVTKGQHSYKKRKRTSECLTYIKEKNYEASDEKRNQNKINPKLTYKKRRLWSNKTETTYKKKRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.34
4 0.45
5 0.54
6 0.63
7 0.68
8 0.76
9 0.8
10 0.83
11 0.82
12 0.81
13 0.79
14 0.74
15 0.7
16 0.66
17 0.61
18 0.54
19 0.47
20 0.37
21 0.32
22 0.27
23 0.26
24 0.23
25 0.24
26 0.28
27 0.32
28 0.38
29 0.42
30 0.45
31 0.45
32 0.49
33 0.55
34 0.56
35 0.59
36 0.56
37 0.57
38 0.63
39 0.71
40 0.74
41 0.73
42 0.74
43 0.73
44 0.8
45 0.84
46 0.84
47 0.84
48 0.84
49 0.84
50 0.81
51 0.81
52 0.78
53 0.78