Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372REB0

Protein Details
Accession A0A372REB0    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
33-58NQWTDESKKKEKIKPIRAANKPKEMDHydrophilic
NLS Segment(s)
PositionSequence
40-54KKKEKIKPIRAANKP
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR026894  DnaJ_X  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF14308  DnaJ-X  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MDLREKLKENKRQLENGEINENEYSIRHNTLLNQWTDESKKKEKIKPIRAANKPKEMDLYEILKLKPSATKDEISSSYRKLAMKYHPDKNGGVETEEWGKISKAYQILADDNSRSLYDNFGTINNSLGSKASFNSHVGGELWQSYIGNLEIGLWLLSFMDNSELENLVSTGEKKRRHDIRVSSIVRYLQNKLFRSPEQDESPQFEESLREEAKKLSDEPNGKKLLSTLGKIYIDEAEAYFNKSSTVESYNFSYLIERFVFYSSIFFGYLTSLTKSKPNPEEVNKLVWKLSKSEISSIAQETCKKVLYDENRSEAESVQIAKSMHLLGKVWLEESKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.71
3 0.65
4 0.62
5 0.52
6 0.48
7 0.41
8 0.37
9 0.26
10 0.2
11 0.2
12 0.15
13 0.18
14 0.16
15 0.17
16 0.21
17 0.29
18 0.35
19 0.33
20 0.33
21 0.32
22 0.36
23 0.4
24 0.44
25 0.43
26 0.45
27 0.52
28 0.58
29 0.65
30 0.7
31 0.76
32 0.8
33 0.82
34 0.84
35 0.86
36 0.86
37 0.9
38 0.87
39 0.86
40 0.77
41 0.69
42 0.63
43 0.55
44 0.49
45 0.43
46 0.38
47 0.31
48 0.34
49 0.32
50 0.3
51 0.29
52 0.26
53 0.26
54 0.25
55 0.29
56 0.29
57 0.31
58 0.29
59 0.34
60 0.36
61 0.36
62 0.36
63 0.3
64 0.3
65 0.32
66 0.32
67 0.29
68 0.32
69 0.37
70 0.44
71 0.5
72 0.54
73 0.56
74 0.58
75 0.57
76 0.53
77 0.49
78 0.39
79 0.33
80 0.26
81 0.22
82 0.22
83 0.22
84 0.19
85 0.14
86 0.14
87 0.13
88 0.13
89 0.15
90 0.12
91 0.13
92 0.14
93 0.15
94 0.17
95 0.18
96 0.19
97 0.16
98 0.15
99 0.15
100 0.14
101 0.13
102 0.12
103 0.12
104 0.1
105 0.11
106 0.11
107 0.11
108 0.13
109 0.11
110 0.12
111 0.11
112 0.11
113 0.1
114 0.09
115 0.09
116 0.08
117 0.09
118 0.09
119 0.1
120 0.11
121 0.12
122 0.11
123 0.12
124 0.11
125 0.11
126 0.1
127 0.09
128 0.08
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.05
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.03
146 0.04
147 0.04
148 0.05
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.05
155 0.05
156 0.06
157 0.11
158 0.17
159 0.22
160 0.24
161 0.33
162 0.39
163 0.43
164 0.5
165 0.51
166 0.53
167 0.58
168 0.58
169 0.5
170 0.45
171 0.44
172 0.39
173 0.35
174 0.31
175 0.25
176 0.3
177 0.3
178 0.31
179 0.32
180 0.3
181 0.35
182 0.36
183 0.36
184 0.33
185 0.35
186 0.34
187 0.35
188 0.37
189 0.3
190 0.26
191 0.22
192 0.18
193 0.16
194 0.21
195 0.17
196 0.15
197 0.15
198 0.16
199 0.18
200 0.19
201 0.19
202 0.18
203 0.24
204 0.31
205 0.35
206 0.4
207 0.41
208 0.39
209 0.37
210 0.33
211 0.34
212 0.29
213 0.26
214 0.21
215 0.24
216 0.24
217 0.24
218 0.24
219 0.17
220 0.15
221 0.14
222 0.12
223 0.1
224 0.1
225 0.13
226 0.12
227 0.12
228 0.12
229 0.12
230 0.12
231 0.12
232 0.16
233 0.14
234 0.16
235 0.2
236 0.2
237 0.2
238 0.19
239 0.18
240 0.15
241 0.17
242 0.16
243 0.13
244 0.12
245 0.14
246 0.14
247 0.12
248 0.13
249 0.11
250 0.12
251 0.11
252 0.1
253 0.09
254 0.1
255 0.11
256 0.12
257 0.13
258 0.13
259 0.13
260 0.19
261 0.22
262 0.29
263 0.34
264 0.4
265 0.46
266 0.51
267 0.59
268 0.55
269 0.61
270 0.55
271 0.51
272 0.46
273 0.42
274 0.37
275 0.32
276 0.34
277 0.32
278 0.32
279 0.35
280 0.36
281 0.35
282 0.36
283 0.35
284 0.34
285 0.31
286 0.32
287 0.32
288 0.3
289 0.3
290 0.27
291 0.27
292 0.32
293 0.37
294 0.44
295 0.47
296 0.5
297 0.49
298 0.5
299 0.49
300 0.4
301 0.34
302 0.26
303 0.22
304 0.18
305 0.2
306 0.19
307 0.18
308 0.2
309 0.19
310 0.18
311 0.18
312 0.18
313 0.17
314 0.22
315 0.22
316 0.22