Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QT06

Protein Details
Accession A0A372QT06   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
21-43LTRNELRKLKKVQLKKLQAQQVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11.833, mito_nucl 10.333, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027450  AlkB-like  
IPR037151  AlkB-like_sf  
IPR032857  ALKBH4  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR005123  Oxoglu/Fe-dep_dioxygenase  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
GO:0070988  P:demethylation  
Pfam View protein in Pfam  
PF13532  2OG-FeII_Oxy_2  
PROSITE View protein in PROSITE  
PS51471  FE2OG_OXY  
PS50102  RRM  
Amino Acid Sequences MIENDLSTSLSKGENNNSSLLTRNELRKLKKVQLKKLQAQQVIVRIEKAPFKKIFSSEPTQYLCLTNLCFGGIGGVTTEKISNIFKSFNGYLGLKLTHGKPYSFIIFNTPSDASRAREILNEKPCDDLDGRMMFIEYVNLTYNNFINQIKNSDKIEIPGLILIEDFITVKQEKNILQQVYSTKSWIPVQDRIVLHYGYSFNYDLNEVGTKLSNLELPSYMNPLLEKLNMLFPSMPKFEQLTIQLYPVGTGIPPHMDHHSSFGPNVIAFSLENPVIMEFKNLKTDKVVNIDLPRRSLLMLKDDVRYAWSHAVRARKSDLLENGQVRERGQRISLTLRTVNPDRICKCSWPELCDRNINSKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.34
5 0.33
6 0.34
7 0.32
8 0.29
9 0.29
10 0.33
11 0.4
12 0.47
13 0.51
14 0.56
15 0.61
16 0.66
17 0.69
18 0.73
19 0.75
20 0.78
21 0.83
22 0.82
23 0.84
24 0.83
25 0.77
26 0.72
27 0.66
28 0.62
29 0.56
30 0.48
31 0.41
32 0.34
33 0.33
34 0.36
35 0.35
36 0.35
37 0.33
38 0.37
39 0.41
40 0.42
41 0.45
42 0.45
43 0.49
44 0.46
45 0.49
46 0.47
47 0.43
48 0.41
49 0.36
50 0.31
51 0.25
52 0.22
53 0.18
54 0.15
55 0.14
56 0.12
57 0.11
58 0.1
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.06
67 0.08
68 0.1
69 0.12
70 0.14
71 0.15
72 0.15
73 0.21
74 0.21
75 0.21
76 0.23
77 0.21
78 0.19
79 0.2
80 0.2
81 0.15
82 0.17
83 0.17
84 0.2
85 0.21
86 0.21
87 0.2
88 0.23
89 0.27
90 0.25
91 0.24
92 0.23
93 0.24
94 0.24
95 0.26
96 0.23
97 0.19
98 0.21
99 0.22
100 0.19
101 0.18
102 0.19
103 0.17
104 0.2
105 0.23
106 0.28
107 0.34
108 0.34
109 0.32
110 0.33
111 0.32
112 0.31
113 0.28
114 0.22
115 0.18
116 0.17
117 0.16
118 0.14
119 0.15
120 0.11
121 0.11
122 0.1
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.08
129 0.09
130 0.09
131 0.1
132 0.1
133 0.11
134 0.12
135 0.16
136 0.17
137 0.2
138 0.21
139 0.21
140 0.2
141 0.2
142 0.2
143 0.16
144 0.14
145 0.11
146 0.1
147 0.08
148 0.07
149 0.06
150 0.05
151 0.04
152 0.04
153 0.03
154 0.06
155 0.06
156 0.07
157 0.08
158 0.1
159 0.11
160 0.16
161 0.21
162 0.19
163 0.19
164 0.21
165 0.22
166 0.24
167 0.23
168 0.2
169 0.15
170 0.16
171 0.17
172 0.19
173 0.2
174 0.21
175 0.22
176 0.28
177 0.28
178 0.28
179 0.28
180 0.25
181 0.21
182 0.18
183 0.17
184 0.1
185 0.13
186 0.11
187 0.09
188 0.1
189 0.1
190 0.08
191 0.09
192 0.09
193 0.07
194 0.07
195 0.08
196 0.07
197 0.07
198 0.08
199 0.08
200 0.08
201 0.09
202 0.09
203 0.1
204 0.11
205 0.13
206 0.13
207 0.11
208 0.11
209 0.11
210 0.12
211 0.1
212 0.1
213 0.08
214 0.12
215 0.12
216 0.13
217 0.13
218 0.13
219 0.17
220 0.19
221 0.18
222 0.15
223 0.16
224 0.16
225 0.18
226 0.2
227 0.19
228 0.18
229 0.18
230 0.18
231 0.16
232 0.16
233 0.13
234 0.1
235 0.06
236 0.06
237 0.07
238 0.08
239 0.09
240 0.11
241 0.14
242 0.15
243 0.16
244 0.2
245 0.22
246 0.2
247 0.19
248 0.19
249 0.17
250 0.15
251 0.15
252 0.11
253 0.09
254 0.08
255 0.09
256 0.1
257 0.09
258 0.09
259 0.08
260 0.09
261 0.09
262 0.09
263 0.12
264 0.13
265 0.14
266 0.23
267 0.24
268 0.24
269 0.27
270 0.31
271 0.32
272 0.35
273 0.35
274 0.31
275 0.38
276 0.43
277 0.41
278 0.4
279 0.36
280 0.31
281 0.29
282 0.29
283 0.24
284 0.24
285 0.28
286 0.28
287 0.3
288 0.3
289 0.29
290 0.27
291 0.25
292 0.22
293 0.25
294 0.24
295 0.25
296 0.29
297 0.38
298 0.38
299 0.41
300 0.43
301 0.39
302 0.4
303 0.43
304 0.45
305 0.43
306 0.48
307 0.46
308 0.45
309 0.45
310 0.44
311 0.38
312 0.39
313 0.35
314 0.3
315 0.3
316 0.29
317 0.29
318 0.35
319 0.38
320 0.36
321 0.38
322 0.38
323 0.42
324 0.44
325 0.48
326 0.46
327 0.52
328 0.49
329 0.51
330 0.52
331 0.5
332 0.52
333 0.54
334 0.54
335 0.51
336 0.58
337 0.59
338 0.61
339 0.65
340 0.63