Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QHK7

Protein Details
Accession A0A372QHK7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
395-414FVASIFAYKRIKKNKNQSSSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 7, mito 5, E.R. 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015915  Kelch-typ_b-propeller  
IPR006652  Kelch_1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01344  Kelch_1  
PF13415  Kelch_3  
Amino Acid Sequences MSTPKNSAMIYKILLIFVLNQLFLLGFGQNYVPEPRVGQAAVIIEDKIYYIGGYKFNQSQPTSDVFYLDVKELKFTWTDLVSLGANLTLTSWHTASSNGISLDSIFILGGVHLDEANLNYVYKFDIKTNVISVPIIQGKTPQPRQGMNSAVSIEGKIYIFGGHVGSGDNIIFVNSLDILDTINLSWSVGSLVNSPVGRIYYTATFLNDGTIYYIGGKVDRNNFSPMTEIYQYDTIGDKWSLKTATAEVAETMPGPRMGHTAVLLGSSKIIVYGGLYYNDDIPYGIPSKETIAMLDITTLVWSIPPLENFNNIPKLAFHSAKLVYDAAMIITFGQKYKWINVPLNLPTKDSIKPKSKSEIPSPNISKTSPPQTNSHSKIVIVCVSIGSVAAGLTLFVASIFAYKRIKKNKNQSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.18
4 0.18
5 0.18
6 0.13
7 0.12
8 0.12
9 0.12
10 0.12
11 0.11
12 0.08
13 0.06
14 0.07
15 0.08
16 0.08
17 0.11
18 0.14
19 0.14
20 0.14
21 0.15
22 0.16
23 0.18
24 0.17
25 0.15
26 0.15
27 0.15
28 0.16
29 0.16
30 0.15
31 0.12
32 0.12
33 0.12
34 0.09
35 0.08
36 0.06
37 0.08
38 0.11
39 0.15
40 0.17
41 0.21
42 0.26
43 0.3
44 0.37
45 0.35
46 0.35
47 0.34
48 0.37
49 0.37
50 0.31
51 0.28
52 0.23
53 0.24
54 0.23
55 0.21
56 0.2
57 0.16
58 0.18
59 0.17
60 0.18
61 0.16
62 0.16
63 0.17
64 0.15
65 0.15
66 0.13
67 0.15
68 0.13
69 0.12
70 0.11
71 0.08
72 0.07
73 0.06
74 0.06
75 0.05
76 0.06
77 0.08
78 0.08
79 0.09
80 0.09
81 0.1
82 0.12
83 0.13
84 0.14
85 0.12
86 0.12
87 0.12
88 0.12
89 0.12
90 0.1
91 0.08
92 0.05
93 0.05
94 0.05
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.07
104 0.07
105 0.07
106 0.07
107 0.07
108 0.09
109 0.11
110 0.11
111 0.11
112 0.16
113 0.17
114 0.19
115 0.21
116 0.2
117 0.19
118 0.18
119 0.17
120 0.15
121 0.17
122 0.16
123 0.14
124 0.17
125 0.22
126 0.31
127 0.34
128 0.36
129 0.35
130 0.38
131 0.41
132 0.42
133 0.4
134 0.33
135 0.31
136 0.26
137 0.23
138 0.21
139 0.18
140 0.13
141 0.1
142 0.08
143 0.07
144 0.06
145 0.06
146 0.06
147 0.06
148 0.06
149 0.05
150 0.05
151 0.06
152 0.05
153 0.06
154 0.05
155 0.05
156 0.05
157 0.05
158 0.04
159 0.04
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.06
177 0.07
178 0.07
179 0.1
180 0.1
181 0.1
182 0.09
183 0.09
184 0.08
185 0.08
186 0.09
187 0.07
188 0.09
189 0.1
190 0.09
191 0.1
192 0.1
193 0.1
194 0.08
195 0.07
196 0.06
197 0.06
198 0.06
199 0.05
200 0.06
201 0.05
202 0.06
203 0.07
204 0.09
205 0.15
206 0.17
207 0.19
208 0.22
209 0.22
210 0.21
211 0.22
212 0.2
213 0.18
214 0.17
215 0.15
216 0.14
217 0.14
218 0.14
219 0.13
220 0.14
221 0.1
222 0.11
223 0.11
224 0.1
225 0.1
226 0.13
227 0.12
228 0.12
229 0.12
230 0.11
231 0.13
232 0.13
233 0.12
234 0.1
235 0.1
236 0.1
237 0.09
238 0.09
239 0.07
240 0.07
241 0.07
242 0.07
243 0.08
244 0.08
245 0.09
246 0.09
247 0.09
248 0.08
249 0.09
250 0.09
251 0.08
252 0.07
253 0.06
254 0.06
255 0.05
256 0.05
257 0.04
258 0.04
259 0.06
260 0.07
261 0.08
262 0.09
263 0.09
264 0.11
265 0.11
266 0.1
267 0.08
268 0.08
269 0.09
270 0.11
271 0.1
272 0.09
273 0.1
274 0.12
275 0.14
276 0.13
277 0.11
278 0.11
279 0.12
280 0.11
281 0.11
282 0.09
283 0.07
284 0.07
285 0.06
286 0.05
287 0.04
288 0.04
289 0.07
290 0.08
291 0.1
292 0.14
293 0.15
294 0.18
295 0.2
296 0.26
297 0.27
298 0.25
299 0.24
300 0.21
301 0.26
302 0.29
303 0.28
304 0.23
305 0.25
306 0.27
307 0.27
308 0.28
309 0.22
310 0.16
311 0.16
312 0.15
313 0.09
314 0.08
315 0.07
316 0.06
317 0.07
318 0.08
319 0.08
320 0.08
321 0.11
322 0.13
323 0.18
324 0.25
325 0.29
326 0.34
327 0.37
328 0.43
329 0.46
330 0.53
331 0.49
332 0.44
333 0.39
334 0.38
335 0.4
336 0.41
337 0.43
338 0.44
339 0.47
340 0.51
341 0.58
342 0.62
343 0.63
344 0.66
345 0.68
346 0.63
347 0.69
348 0.68
349 0.65
350 0.6
351 0.55
352 0.5
353 0.46
354 0.52
355 0.48
356 0.47
357 0.46
358 0.51
359 0.61
360 0.61
361 0.6
362 0.51
363 0.46
364 0.45
365 0.44
366 0.38
367 0.29
368 0.24
369 0.17
370 0.16
371 0.15
372 0.12
373 0.09
374 0.06
375 0.05
376 0.05
377 0.04
378 0.04
379 0.04
380 0.04
381 0.04
382 0.04
383 0.04
384 0.04
385 0.07
386 0.09
387 0.14
388 0.21
389 0.27
390 0.37
391 0.48
392 0.58
393 0.65
394 0.75