Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QW48

Protein Details
Accession A0A372QW48   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-35LESIKKQEPSSKRSRRKANMDKGVVVHydrophilic
NLS Segment(s)
PositionSequence
18-26PSSKRSRRK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MEKPRRTSALESIKKQEPSSKRSRRKANMDKGVVVPSIETSDTPNLEYTTSHEITPSTSQTHLFFVCQVRGVVCGTCTTNLFWIKMVPIIIRPVCXAKIM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.56
3 0.55
4 0.5
5 0.5
6 0.57
7 0.61
8 0.65
9 0.71
10 0.81
11 0.81
12 0.86
13 0.89
14 0.88
15 0.87
16 0.8
17 0.73
18 0.64
19 0.57
20 0.46
21 0.35
22 0.24
23 0.14
24 0.12
25 0.1
26 0.08
27 0.08
28 0.1
29 0.1
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.11
36 0.15
37 0.16
38 0.15
39 0.14
40 0.14
41 0.16
42 0.18
43 0.16
44 0.12
45 0.12
46 0.13
47 0.14
48 0.16
49 0.15
50 0.13
51 0.14
52 0.15
53 0.15
54 0.15
55 0.14
56 0.12
57 0.13
58 0.14
59 0.11
60 0.1
61 0.11
62 0.11
63 0.12
64 0.13
65 0.13
66 0.17
67 0.19
68 0.19
69 0.18
70 0.18
71 0.18
72 0.19
73 0.19
74 0.15
75 0.15
76 0.22
77 0.22
78 0.23
79 0.24