Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q8C6

Protein Details
Accession A0A372Q8C6   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
75-103LVKPSKPAPKTTKKQKSNLKPVFRNTCSRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14.833, cyto 8, cyto_pero 4.999
Family & Domain DBs
Amino Acid Sequences DFESDLTRSLNNFNNKVTNSEQYSLLDNNNQIMTVSEEALLASSTRLDIELNNTCDQSLSKKVDRNTNDQCDQELVKPSKPAPKTTKKQKSNLKPVFRNTCSRAAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.42
4 0.41
5 0.4
6 0.37
7 0.36
8 0.35
9 0.3
10 0.32
11 0.29
12 0.26
13 0.23
14 0.18
15 0.18
16 0.17
17 0.15
18 0.12
19 0.11
20 0.12
21 0.1
22 0.1
23 0.09
24 0.09
25 0.08
26 0.09
27 0.08
28 0.05
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.09
37 0.14
38 0.16
39 0.17
40 0.17
41 0.16
42 0.17
43 0.17
44 0.16
45 0.17
46 0.19
47 0.22
48 0.27
49 0.3
50 0.38
51 0.41
52 0.46
53 0.48
54 0.5
55 0.5
56 0.46
57 0.44
58 0.38
59 0.37
60 0.31
61 0.32
62 0.27
63 0.26
64 0.28
65 0.3
66 0.36
67 0.37
68 0.43
69 0.44
70 0.52
71 0.6
72 0.69
73 0.77
74 0.77
75 0.85
76 0.87
77 0.88
78 0.89
79 0.89
80 0.88
81 0.85
82 0.86
83 0.87
84 0.81
85 0.78
86 0.72