Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q5Q9

Protein Details
Accession A0A372Q5Q9   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-43IQKIKLCDNNNKKTRRKPLKLCSDCKETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSKNYGLRTGGAPYIQKIKLCDNNNKKTRRKPLKLCSDCKETKACVSLISSKVNRIEEIINNYYKNSNKKIEQISKFNTKFTLNNVPCELEYDLSNFTLENLQKLAIFTTQNYGNNNSYNVSSKHSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.29
3 0.29
4 0.29
5 0.28
6 0.34
7 0.4
8 0.44
9 0.53
10 0.55
11 0.64
12 0.7
13 0.77
14 0.77
15 0.79
16 0.84
17 0.85
18 0.85
19 0.85
20 0.86
21 0.89
22 0.89
23 0.86
24 0.81
25 0.79
26 0.71
27 0.63
28 0.57
29 0.47
30 0.4
31 0.36
32 0.3
33 0.22
34 0.22
35 0.25
36 0.23
37 0.27
38 0.25
39 0.25
40 0.28
41 0.27
42 0.25
43 0.21
44 0.21
45 0.17
46 0.23
47 0.23
48 0.21
49 0.21
50 0.21
51 0.22
52 0.24
53 0.25
54 0.24
55 0.26
56 0.26
57 0.32
58 0.4
59 0.46
60 0.48
61 0.5
62 0.51
63 0.56
64 0.55
65 0.5
66 0.44
67 0.37
68 0.33
69 0.32
70 0.38
71 0.29
72 0.32
73 0.33
74 0.32
75 0.29
76 0.31
77 0.27
78 0.17
79 0.16
80 0.14
81 0.14
82 0.13
83 0.13
84 0.1
85 0.09
86 0.14
87 0.14
88 0.13
89 0.13
90 0.13
91 0.14
92 0.14
93 0.15
94 0.12
95 0.13
96 0.12
97 0.16
98 0.21
99 0.23
100 0.26
101 0.29
102 0.29
103 0.3
104 0.31
105 0.28
106 0.26
107 0.28
108 0.26