Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QX55

Protein Details
Accession A0A372QX55   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-39VKQHENRLAQDKKNKCKKKERLALLNIDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046700  DUF6570  
Pfam View protein in Pfam  
PF20209  DUF6570  
Amino Acid Sequences MKIKNRVDKTVKQHENRLAQDKKNKCKKKERLALLNIDEQLNRQDELTQKDSDKSQFPKADRKLLLDNIITAISITKILLKFSADNNMDPGDVSEELCNLTEIKEMLIARIFSIVSIYCLHSDQYAYRDGLINNQLLQIDDVEQCFNDNDDIYEDTIGSNFVSASLSSSNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.73
4 0.74
5 0.7
6 0.68
7 0.73
8 0.74
9 0.76
10 0.78
11 0.81
12 0.8
13 0.84
14 0.87
15 0.89
16 0.89
17 0.88
18 0.87
19 0.84
20 0.83
21 0.75
22 0.7
23 0.6
24 0.5
25 0.41
26 0.31
27 0.27
28 0.21
29 0.17
30 0.13
31 0.14
32 0.17
33 0.23
34 0.26
35 0.25
36 0.25
37 0.26
38 0.29
39 0.29
40 0.31
41 0.29
42 0.33
43 0.36
44 0.38
45 0.47
46 0.48
47 0.53
48 0.48
49 0.48
50 0.45
51 0.41
52 0.42
53 0.32
54 0.28
55 0.21
56 0.19
57 0.15
58 0.1
59 0.08
60 0.05
61 0.05
62 0.05
63 0.07
64 0.07
65 0.07
66 0.08
67 0.09
68 0.1
69 0.1
70 0.18
71 0.16
72 0.16
73 0.17
74 0.17
75 0.16
76 0.14
77 0.14
78 0.08
79 0.08
80 0.08
81 0.07
82 0.06
83 0.07
84 0.07
85 0.07
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.09
92 0.09
93 0.09
94 0.11
95 0.1
96 0.09
97 0.1
98 0.1
99 0.07
100 0.08
101 0.07
102 0.07
103 0.08
104 0.09
105 0.09
106 0.1
107 0.1
108 0.1
109 0.11
110 0.11
111 0.12
112 0.14
113 0.14
114 0.14
115 0.17
116 0.16
117 0.2
118 0.22
119 0.21
120 0.18
121 0.19
122 0.18
123 0.16
124 0.16
125 0.12
126 0.11
127 0.11
128 0.11
129 0.11
130 0.11
131 0.11
132 0.11
133 0.11
134 0.1
135 0.1
136 0.1
137 0.12
138 0.13
139 0.13
140 0.13
141 0.12
142 0.11
143 0.11
144 0.11
145 0.08
146 0.07
147 0.05
148 0.06
149 0.07
150 0.06
151 0.09
152 0.1