Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QM61

Protein Details
Accession A0A372QM61    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
42-66DKDEKNIKDTRKKIRRLKVAKALYNHydrophilic
NLS Segment(s)
PositionSequence
51-59TRKKIRRLK
Subcellular Location(s) nucl 18.5, cyto_nucl 14.833, cyto 8, cyto_pero 4.999
Family & Domain DBs
Amino Acid Sequences MELQYRIDKLNKELEKNNDSEDSDNEIFDIDIEMDEKDEKDDKDEKNIKDTRKKIRRLKVAKALYNKDDARITHYEKQEMINIIQDMRYHSLELSEMDEETSSDKCQIVLKTLLREVLDLYSFIQQNAQLIRRKNYDDTLQNFNVQPPNDAPQWTCIDPENGNIVYDSDIGYESIYDDIMCDTDTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.53
4 0.52
5 0.46
6 0.42
7 0.38
8 0.34
9 0.33
10 0.29
11 0.27
12 0.23
13 0.19
14 0.17
15 0.15
16 0.14
17 0.06
18 0.06
19 0.06
20 0.06
21 0.07
22 0.08
23 0.08
24 0.1
25 0.13
26 0.13
27 0.18
28 0.25
29 0.25
30 0.35
31 0.43
32 0.41
33 0.47
34 0.53
35 0.55
36 0.58
37 0.65
38 0.65
39 0.67
40 0.76
41 0.76
42 0.8
43 0.83
44 0.81
45 0.83
46 0.82
47 0.8
48 0.77
49 0.75
50 0.7
51 0.61
52 0.6
53 0.51
54 0.43
55 0.37
56 0.31
57 0.29
58 0.29
59 0.32
60 0.32
61 0.34
62 0.33
63 0.31
64 0.32
65 0.29
66 0.26
67 0.21
68 0.17
69 0.15
70 0.14
71 0.14
72 0.13
73 0.12
74 0.13
75 0.13
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.1
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.07
88 0.07
89 0.06
90 0.07
91 0.07
92 0.07
93 0.11
94 0.11
95 0.13
96 0.18
97 0.19
98 0.21
99 0.21
100 0.23
101 0.19
102 0.19
103 0.17
104 0.13
105 0.11
106 0.09
107 0.1
108 0.12
109 0.12
110 0.12
111 0.12
112 0.11
113 0.13
114 0.16
115 0.2
116 0.21
117 0.24
118 0.29
119 0.32
120 0.35
121 0.36
122 0.36
123 0.38
124 0.41
125 0.42
126 0.45
127 0.42
128 0.41
129 0.39
130 0.39
131 0.37
132 0.3
133 0.28
134 0.23
135 0.26
136 0.25
137 0.26
138 0.23
139 0.23
140 0.27
141 0.25
142 0.25
143 0.22
144 0.24
145 0.23
146 0.25
147 0.25
148 0.2
149 0.2
150 0.19
151 0.18
152 0.16
153 0.16
154 0.13
155 0.09
156 0.09
157 0.09
158 0.09
159 0.08
160 0.07
161 0.07
162 0.07
163 0.06
164 0.06
165 0.07
166 0.07