Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QIN1

Protein Details
Accession A0A372QIN1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
80-102QVFGKPLNSRKSKRFARKRLVREHydrophilic
NLS Segment(s)
PositionSequence
88-101SRKSKRFARKRLVR
Subcellular Location(s) mito 11, cyto 8, cyto_nucl 6.5, nucl 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR014044  CAP_domain  
IPR035940  CAP_sf  
Pfam View protein in Pfam  
PF00188  CAP  
CDD cd05379  CAP_bacterial  
Amino Acid Sequences MVKTDTLTHDDDAGSLGERIKAEGYNFSNAGENIAEGFGTNDEARVMKAWMGSSGHKANILNKAFTNLGVGFGGGKYWTQVFGKPLNSRKSKRFARKRLVRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.1
4 0.11
5 0.11
6 0.12
7 0.12
8 0.13
9 0.13
10 0.18
11 0.2
12 0.22
13 0.22
14 0.21
15 0.22
16 0.21
17 0.21
18 0.14
19 0.12
20 0.08
21 0.08
22 0.07
23 0.05
24 0.06
25 0.04
26 0.06
27 0.06
28 0.05
29 0.06
30 0.06
31 0.07
32 0.07
33 0.07
34 0.06
35 0.07
36 0.07
37 0.08
38 0.09
39 0.1
40 0.13
41 0.14
42 0.14
43 0.15
44 0.15
45 0.17
46 0.24
47 0.24
48 0.22
49 0.2
50 0.23
51 0.21
52 0.21
53 0.2
54 0.12
55 0.12
56 0.1
57 0.1
58 0.08
59 0.08
60 0.08
61 0.06
62 0.05
63 0.05
64 0.06
65 0.09
66 0.09
67 0.12
68 0.16
69 0.2
70 0.27
71 0.34
72 0.41
73 0.48
74 0.56
75 0.6
76 0.64
77 0.7
78 0.74
79 0.77
80 0.81
81 0.82
82 0.84