Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q8P7

Protein Details
Accession A0A372Q8P7    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-29AIPNKVKKENLQKKEKRLIGLHydrophilic
NLS Segment(s)
PositionSequence
19-30LQKKEKRLIGLK
Subcellular Location(s) nucl 9, mito 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MIVINTIIAIPNKVKKENLQKKEKRLIGLKKTAILKKTDGLIICDTGPKDXSPTLRWTSPSFYDFDFSDSLEYWVNFSFPGFLEYWVNVWDFSFSDSLGYWILASWVLWDIRIQLSGFFRILDKFQLSEFFDIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.48
4 0.57
5 0.62
6 0.67
7 0.71
8 0.77
9 0.85
10 0.8
11 0.75
12 0.74
13 0.74
14 0.72
15 0.73
16 0.65
17 0.61
18 0.64
19 0.61
20 0.55
21 0.48
22 0.41
23 0.34
24 0.34
25 0.31
26 0.25
27 0.24
28 0.22
29 0.2
30 0.18
31 0.18
32 0.16
33 0.14
34 0.15
35 0.12
36 0.13
37 0.12
38 0.14
39 0.15
40 0.19
41 0.18
42 0.21
43 0.22
44 0.23
45 0.25
46 0.24
47 0.22
48 0.18
49 0.19
50 0.15
51 0.16
52 0.13
53 0.11
54 0.1
55 0.1
56 0.1
57 0.09
58 0.09
59 0.08
60 0.07
61 0.08
62 0.07
63 0.06
64 0.06
65 0.05
66 0.08
67 0.08
68 0.09
69 0.1
70 0.1
71 0.11
72 0.11
73 0.11
74 0.08
75 0.08
76 0.08
77 0.07
78 0.08
79 0.08
80 0.07
81 0.07
82 0.07
83 0.09
84 0.08
85 0.08
86 0.06
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.07
93 0.07
94 0.08
95 0.08
96 0.1
97 0.11
98 0.13
99 0.12
100 0.13
101 0.16
102 0.18
103 0.18
104 0.17
105 0.17
106 0.17
107 0.18
108 0.2
109 0.19
110 0.18
111 0.18
112 0.23
113 0.25