Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RQI7

Protein Details
Accession A0A372RQI7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-42MSEIDSKKRTRSKTKNDDVSLNKPQPKKSRGKKEIKDENPPEHydrophilic
NLS Segment(s)
PositionSequence
22-34NKPQPKKSRGKKE
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017930  Myb_dom  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS51294  HTH_MYB  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MSEIDSKKRTRSKTKNDDVSLNKPQPKKSRGKKEIKDENPPESDAPPSLENNNEVEGVSSQAQSKKWTPEQRLQLIEAVLKHVKVPWDEVSNEVDGGKNGKMCYDQWRRKIVPGLKTYINSDHEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.83
4 0.83
5 0.79
6 0.76
7 0.74
8 0.7
9 0.67
10 0.61
11 0.65
12 0.65
13 0.67
14 0.7
15 0.71
16 0.75
17 0.78
18 0.85
19 0.85
20 0.87
21 0.89
22 0.85
23 0.85
24 0.78
25 0.73
26 0.64
27 0.58
28 0.48
29 0.38
30 0.33
31 0.23
32 0.21
33 0.16
34 0.15
35 0.15
36 0.14
37 0.15
38 0.14
39 0.15
40 0.12
41 0.11
42 0.1
43 0.09
44 0.1
45 0.09
46 0.08
47 0.09
48 0.11
49 0.12
50 0.14
51 0.16
52 0.2
53 0.27
54 0.33
55 0.37
56 0.42
57 0.49
58 0.51
59 0.51
60 0.46
61 0.4
62 0.34
63 0.3
64 0.23
65 0.19
66 0.15
67 0.13
68 0.12
69 0.12
70 0.14
71 0.14
72 0.17
73 0.17
74 0.2
75 0.2
76 0.22
77 0.23
78 0.21
79 0.2
80 0.17
81 0.14
82 0.11
83 0.13
84 0.12
85 0.12
86 0.11
87 0.13
88 0.14
89 0.16
90 0.26
91 0.35
92 0.42
93 0.47
94 0.56
95 0.57
96 0.61
97 0.69
98 0.65
99 0.63
100 0.6
101 0.59
102 0.55
103 0.55
104 0.53
105 0.5