Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RBH4

Protein Details
Accession A0A372RBH4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-35KESGPKWKGKIERKRKYEPDKRIPNTDBasic
NLS Segment(s)
PositionSequence
11-27SGPKWKGKIERKRKYEP
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MYLRVEEPKESGPKWKGKIERKRKYEPDKRIPNTDLQKREYQTDLQKRKEPDEEDELGLQLSALKNELEYYWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.54
3 0.57
4 0.62
5 0.72
6 0.74
7 0.78
8 0.78
9 0.83
10 0.85
11 0.87
12 0.86
13 0.86
14 0.85
15 0.86
16 0.81
17 0.78
18 0.69
19 0.66
20 0.65
21 0.62
22 0.56
23 0.48
24 0.49
25 0.44
26 0.45
27 0.39
28 0.35
29 0.37
30 0.42
31 0.47
32 0.47
33 0.51
34 0.52
35 0.54
36 0.56
37 0.5
38 0.45
39 0.44
40 0.41
41 0.38
42 0.36
43 0.32
44 0.25
45 0.22
46 0.16
47 0.12
48 0.09
49 0.08
50 0.08
51 0.08
52 0.09
53 0.1