Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QMM2

Protein Details
Accession A0A372QMM2    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
225-252GGKLNNKGKNKRGQKQYNRKKGKTDEETBasic
NLS Segment(s)
PositionSequence
228-247LNNKGKNKRGQKQYNRKKGK
Subcellular Location(s) nucl 18, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039905  CD2BP2/Lin1  
Gene Ontology GO:0005682  C:U5 snRNP  
Amino Acid Sequences SSSKRVRFHTSNDSTAISAANEEGEYEFDHEDSLEKAKTRRGAVKLQGYASDETDTSDDDGTALFNRRKENIAEDVDDMFADDDIPKKENSKDLDGKKKVRYLELDEIEGQEYTSKDAYDEESGETIIEAFNMKAEMEEGRFDEAGNYIRNKKDPNAFHDNWLQGVSRKDIEKAKRAHEKQEQERKLKEAEEASKGPLDRISIWKELLTIMKRGETLLDALQRLGGKLNNKGKNKRGQKQYNRKKGKTDEETEMIIDKELTSEEILEQECKKQIERLTDLSDKMMALGHFNVYDDTWEQILRNLKREGIVPEDWVPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.4
3 0.33
4 0.22
5 0.16
6 0.12
7 0.1
8 0.08
9 0.09
10 0.08
11 0.09
12 0.09
13 0.11
14 0.11
15 0.1
16 0.11
17 0.1
18 0.11
19 0.11
20 0.14
21 0.14
22 0.17
23 0.19
24 0.25
25 0.3
26 0.35
27 0.42
28 0.43
29 0.49
30 0.55
31 0.62
32 0.6
33 0.56
34 0.53
35 0.48
36 0.44
37 0.37
38 0.3
39 0.21
40 0.18
41 0.17
42 0.15
43 0.13
44 0.12
45 0.1
46 0.09
47 0.09
48 0.08
49 0.1
50 0.15
51 0.17
52 0.19
53 0.23
54 0.25
55 0.27
56 0.28
57 0.31
58 0.32
59 0.32
60 0.31
61 0.3
62 0.29
63 0.26
64 0.24
65 0.19
66 0.12
67 0.09
68 0.07
69 0.06
70 0.08
71 0.1
72 0.12
73 0.12
74 0.14
75 0.17
76 0.22
77 0.26
78 0.31
79 0.38
80 0.45
81 0.55
82 0.6
83 0.64
84 0.64
85 0.64
86 0.57
87 0.53
88 0.5
89 0.47
90 0.48
91 0.43
92 0.4
93 0.36
94 0.35
95 0.31
96 0.26
97 0.19
98 0.11
99 0.1
100 0.09
101 0.09
102 0.08
103 0.08
104 0.09
105 0.11
106 0.11
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.09
113 0.07
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.05
123 0.05
124 0.06
125 0.07
126 0.07
127 0.08
128 0.08
129 0.08
130 0.08
131 0.09
132 0.1
133 0.11
134 0.13
135 0.14
136 0.16
137 0.18
138 0.19
139 0.22
140 0.27
141 0.29
142 0.34
143 0.4
144 0.4
145 0.41
146 0.43
147 0.39
148 0.32
149 0.3
150 0.23
151 0.16
152 0.17
153 0.16
154 0.14
155 0.14
156 0.17
157 0.22
158 0.26
159 0.31
160 0.33
161 0.39
162 0.47
163 0.48
164 0.53
165 0.55
166 0.6
167 0.63
168 0.7
169 0.7
170 0.65
171 0.65
172 0.59
173 0.53
174 0.45
175 0.37
176 0.32
177 0.28
178 0.28
179 0.27
180 0.26
181 0.26
182 0.25
183 0.23
184 0.19
185 0.16
186 0.14
187 0.17
188 0.2
189 0.2
190 0.2
191 0.2
192 0.19
193 0.19
194 0.22
195 0.19
196 0.17
197 0.16
198 0.17
199 0.17
200 0.17
201 0.16
202 0.12
203 0.12
204 0.12
205 0.14
206 0.13
207 0.13
208 0.15
209 0.14
210 0.14
211 0.14
212 0.14
213 0.14
214 0.23
215 0.32
216 0.39
217 0.46
218 0.53
219 0.59
220 0.66
221 0.74
222 0.74
223 0.76
224 0.79
225 0.83
226 0.87
227 0.9
228 0.91
229 0.92
230 0.87
231 0.85
232 0.82
233 0.82
234 0.79
235 0.74
236 0.69
237 0.61
238 0.58
239 0.5
240 0.42
241 0.32
242 0.23
243 0.18
244 0.11
245 0.09
246 0.08
247 0.08
248 0.07
249 0.08
250 0.08
251 0.1
252 0.11
253 0.14
254 0.14
255 0.17
256 0.21
257 0.22
258 0.23
259 0.26
260 0.3
261 0.35
262 0.4
263 0.41
264 0.44
265 0.47
266 0.46
267 0.42
268 0.39
269 0.3
270 0.25
271 0.22
272 0.16
273 0.14
274 0.14
275 0.14
276 0.13
277 0.14
278 0.14
279 0.12
280 0.14
281 0.13
282 0.14
283 0.13
284 0.14
285 0.13
286 0.17
287 0.27
288 0.28
289 0.33
290 0.33
291 0.34
292 0.35
293 0.39
294 0.38
295 0.35
296 0.33
297 0.32