Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372Q8X4

Protein Details
Accession A0A372Q8X4    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-64KGYYIRHVKNKWKNDNNVKKAYRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12.333, cyto_nucl 9.166, mito 9
Family & Domain DBs
Amino Acid Sequences MLENDKVCASYLKELKKKGMTYDRLWNKKLYSEILAANHIKKGYYIRHVKNKWKNDNNVKKAYRDLYSLKDSGFEKDPYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.55
4 0.54
5 0.54
6 0.57
7 0.54
8 0.52
9 0.6
10 0.63
11 0.62
12 0.62
13 0.56
14 0.47
15 0.45
16 0.42
17 0.34
18 0.27
19 0.23
20 0.23
21 0.22
22 0.24
23 0.22
24 0.2
25 0.19
26 0.16
27 0.14
28 0.12
29 0.15
30 0.15
31 0.22
32 0.3
33 0.35
34 0.46
35 0.51
36 0.61
37 0.67
38 0.74
39 0.76
40 0.76
41 0.8
42 0.81
43 0.86
44 0.83
45 0.84
46 0.76
47 0.68
48 0.65
49 0.6
50 0.51
51 0.45
52 0.41
53 0.37
54 0.4
55 0.39
56 0.33
57 0.33
58 0.32
59 0.31
60 0.32