Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QUS9

Protein Details
Accession A0A372QUS9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-61NKDFWHIPKKRKKREEMMNSSSRHydrophilic
NLS Segment(s)
PositionSequence
46-52PKKRKKR
Subcellular Location(s) mito 7, plas 6, E.R. 5, pero 3, golg 3, nucl 2
Family & Domain DBs
Amino Acid Sequences MKLKLVGMSHVLLTCFFLFIKRVKLKIIDDSEKIPEFFNKDFWHIPKKRKKREEMMNSSSRKKNWCSGTNLVRRENSYFSGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.1
5 0.12
6 0.14
7 0.23
8 0.25
9 0.26
10 0.28
11 0.32
12 0.33
13 0.39
14 0.43
15 0.38
16 0.35
17 0.36
18 0.37
19 0.34
20 0.32
21 0.24
22 0.19
23 0.19
24 0.18
25 0.19
26 0.17
27 0.19
28 0.21
29 0.23
30 0.32
31 0.34
32 0.43
33 0.5
34 0.6
35 0.67
36 0.74
37 0.79
38 0.79
39 0.84
40 0.85
41 0.84
42 0.82
43 0.8
44 0.75
45 0.74
46 0.69
47 0.61
48 0.55
49 0.5
50 0.5
51 0.5
52 0.52
53 0.53
54 0.57
55 0.64
56 0.68
57 0.7
58 0.67
59 0.62
60 0.59
61 0.55
62 0.5