Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QEL1

Protein Details
Accession A0A372QEL1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-26IFPIHKEKTNGKKKKYGKNVDTHydrophilic
NLS Segment(s)
PositionSequence
16-18KKK
Subcellular Location(s) cyto_nucl 11.5, cyto 10.5, nucl 9.5, mito 7
Family & Domain DBs
Amino Acid Sequences MEFLIFPIHKEKTNGKKKKYGKNVDTMCLPTSYSTGVPPLPELCNDCFNLLEDNGGEADTFSENDGLKEESQDLENDIEEYKDIQERDINLQVALEDIDKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.62
3 0.7
4 0.76
5 0.82
6 0.84
7 0.84
8 0.79
9 0.8
10 0.77
11 0.71
12 0.65
13 0.57
14 0.47
15 0.36
16 0.3
17 0.2
18 0.17
19 0.15
20 0.12
21 0.1
22 0.11
23 0.1
24 0.1
25 0.11
26 0.12
27 0.11
28 0.12
29 0.14
30 0.14
31 0.16
32 0.16
33 0.16
34 0.14
35 0.14
36 0.14
37 0.11
38 0.09
39 0.07
40 0.07
41 0.06
42 0.06
43 0.05
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.07
50 0.07
51 0.07
52 0.09
53 0.1
54 0.09
55 0.1
56 0.11
57 0.1
58 0.11
59 0.11
60 0.11
61 0.1
62 0.1
63 0.1
64 0.1
65 0.09
66 0.08
67 0.09
68 0.09
69 0.12
70 0.12
71 0.13
72 0.17
73 0.19
74 0.25
75 0.29
76 0.28
77 0.24
78 0.24
79 0.22
80 0.19
81 0.18