Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372Q8X9

Protein Details
Accession A0A372Q8X9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
45-69DLCQDCKPKSHKHRHPNDHRLKLIPBasic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000433  Znf_ZZ  
IPR043145  Znf_ZZ_sf  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00569  ZZ  
PROSITE View protein in PROSITE  
PS50135  ZF_ZZ_2  
Amino Acid Sequences MKNNYEKQIRGPPSEPVLHYGVGCDCCNHTIRGKRWNCTTCVIYDLCQDCKPKSHKHRHPNDHRLKLIPHSDTSKYAPRMCYHIFFVYSIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.44
3 0.38
4 0.34
5 0.29
6 0.27
7 0.23
8 0.2
9 0.19
10 0.18
11 0.15
12 0.14
13 0.15
14 0.17
15 0.18
16 0.21
17 0.27
18 0.31
19 0.41
20 0.44
21 0.47
22 0.54
23 0.55
24 0.51
25 0.47
26 0.44
27 0.34
28 0.32
29 0.28
30 0.2
31 0.21
32 0.21
33 0.19
34 0.2
35 0.21
36 0.19
37 0.25
38 0.3
39 0.35
40 0.44
41 0.53
42 0.6
43 0.69
44 0.8
45 0.84
46 0.9
47 0.91
48 0.91
49 0.88
50 0.81
51 0.74
52 0.66
53 0.61
54 0.56
55 0.48
56 0.4
57 0.37
58 0.37
59 0.37
60 0.39
61 0.41
62 0.4
63 0.41
64 0.42
65 0.39
66 0.44
67 0.44
68 0.43
69 0.39
70 0.38
71 0.35