Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RBX0

Protein Details
Accession A0A372RBX0   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
69-96PDYVYQPKKPGTKKRKSTQRNDKSNKPTHydrophilic
NLS Segment(s)
PositionSequence
76-90KKPGTKKRKSTQRND
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences PKRTPRPPNAFILYRKAKQPDVVAQNKNLTNAEVSKVISKMWWKETEEERFQWEKRADRMKLKHMQDYPDYVYQPKKPGTKKRKSTQRNDKSNKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.54
4 0.49
5 0.46
6 0.47
7 0.46
8 0.47
9 0.53
10 0.5
11 0.48
12 0.52
13 0.49
14 0.46
15 0.37
16 0.29
17 0.22
18 0.2
19 0.19
20 0.15
21 0.14
22 0.14
23 0.14
24 0.13
25 0.13
26 0.15
27 0.17
28 0.19
29 0.23
30 0.22
31 0.27
32 0.32
33 0.37
34 0.37
35 0.34
36 0.35
37 0.34
38 0.33
39 0.35
40 0.33
41 0.31
42 0.34
43 0.42
44 0.4
45 0.46
46 0.51
47 0.53
48 0.58
49 0.58
50 0.58
51 0.53
52 0.54
53 0.47
54 0.47
55 0.43
56 0.38
57 0.36
58 0.31
59 0.33
60 0.33
61 0.36
62 0.38
63 0.41
64 0.47
65 0.57
66 0.65
67 0.71
68 0.78
69 0.83
70 0.88
71 0.9
72 0.92
73 0.92
74 0.92
75 0.93
76 0.91