Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QIS8

Protein Details
Accession A0A372QIS8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
14-41PPYVQKFRFENKIKKRKPIKNCLDCKEMHydrophilic
NLS Segment(s)
PositionSequence
27-30KKRK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, mito 7, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSSKNYGKKACGTPPYVQKFRFENKIKKRKPIKNCLDCKEMSDSVKLFSSKVNKIEEVINNFYKNPIKNINNNQFSIFNAKFTLNNIPCELEYDLSKFSLENLHKLAIFTTQHCNNDNKYSSSISSNEDIDEKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.67
3 0.66
4 0.6
5 0.57
6 0.57
7 0.58
8 0.61
9 0.6
10 0.61
11 0.66
12 0.76
13 0.76
14 0.8
15 0.84
16 0.84
17 0.85
18 0.86
19 0.86
20 0.85
21 0.88
22 0.83
23 0.78
24 0.69
25 0.61
26 0.56
27 0.48
28 0.39
29 0.33
30 0.27
31 0.23
32 0.26
33 0.23
34 0.17
35 0.18
36 0.23
37 0.23
38 0.27
39 0.28
40 0.25
41 0.26
42 0.3
43 0.3
44 0.29
45 0.3
46 0.28
47 0.26
48 0.25
49 0.26
50 0.25
51 0.23
52 0.21
53 0.24
54 0.25
55 0.32
56 0.41
57 0.48
58 0.48
59 0.48
60 0.47
61 0.39
62 0.37
63 0.37
64 0.27
65 0.19
66 0.17
67 0.17
68 0.16
69 0.17
70 0.26
71 0.21
72 0.22
73 0.23
74 0.22
75 0.22
76 0.24
77 0.23
78 0.15
79 0.14
80 0.14
81 0.14
82 0.13
83 0.13
84 0.1
85 0.1
86 0.17
87 0.17
88 0.19
89 0.2
90 0.21
91 0.22
92 0.22
93 0.22
94 0.19
95 0.2
96 0.19
97 0.24
98 0.28
99 0.31
100 0.34
101 0.37
102 0.36
103 0.42
104 0.43
105 0.39
106 0.37
107 0.37
108 0.36
109 0.36
110 0.34
111 0.3
112 0.29
113 0.26
114 0.25