Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q6R4

Protein Details
Accession A0A372Q6R4    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-30EESVNIKKLKKKWPNMIPSDINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto 8, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013083  Znf_RING/FYVE/PHD  
IPR001607  Znf_UBP  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF02148  zf-UBP  
PROSITE View protein in PROSITE  
PS50271  ZF_UBP  
Amino Acid Sequences MEYNCEHVEESVNIKKLKKKWPNMIPSDINCITCVNNHAKALSEQTIWLCLTCCKPHCSRFDERHGIQHYEEKVNHNISLDLKNFKAWCYECKRYVFPSLNKNQAIAQAQAIIQKYFRRYMEEEDTESYSTLDCLNISCKHVIESVNIKKLEKKLPNLVPLNIKCTTCVNNNTKALSKQSIWLCLTCKPYCSRFDEKHGIQHYEEKANHNISLDLKTYKAWYVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.49
4 0.58
5 0.62
6 0.65
7 0.7
8 0.77
9 0.83
10 0.83
11 0.83
12 0.79
13 0.71
14 0.7
15 0.61
16 0.51
17 0.42
18 0.36
19 0.28
20 0.23
21 0.25
22 0.22
23 0.24
24 0.24
25 0.23
26 0.24
27 0.25
28 0.28
29 0.26
30 0.21
31 0.19
32 0.18
33 0.21
34 0.19
35 0.17
36 0.13
37 0.13
38 0.17
39 0.21
40 0.24
41 0.27
42 0.33
43 0.39
44 0.45
45 0.49
46 0.54
47 0.56
48 0.63
49 0.66
50 0.61
51 0.63
52 0.61
53 0.56
54 0.48
55 0.46
56 0.4
57 0.36
58 0.37
59 0.32
60 0.32
61 0.32
62 0.31
63 0.26
64 0.24
65 0.21
66 0.24
67 0.22
68 0.2
69 0.19
70 0.21
71 0.21
72 0.2
73 0.22
74 0.19
75 0.25
76 0.31
77 0.36
78 0.38
79 0.42
80 0.44
81 0.41
82 0.47
83 0.47
84 0.43
85 0.47
86 0.47
87 0.51
88 0.48
89 0.46
90 0.39
91 0.36
92 0.33
93 0.24
94 0.19
95 0.13
96 0.13
97 0.15
98 0.15
99 0.11
100 0.11
101 0.12
102 0.14
103 0.16
104 0.16
105 0.18
106 0.19
107 0.25
108 0.3
109 0.3
110 0.3
111 0.28
112 0.29
113 0.25
114 0.24
115 0.18
116 0.11
117 0.1
118 0.08
119 0.06
120 0.05
121 0.05
122 0.09
123 0.1
124 0.13
125 0.13
126 0.13
127 0.14
128 0.16
129 0.17
130 0.16
131 0.24
132 0.27
133 0.33
134 0.34
135 0.33
136 0.35
137 0.4
138 0.45
139 0.42
140 0.42
141 0.45
142 0.5
143 0.57
144 0.56
145 0.54
146 0.54
147 0.49
148 0.49
149 0.42
150 0.37
151 0.3
152 0.3
153 0.3
154 0.27
155 0.35
156 0.35
157 0.4
158 0.42
159 0.44
160 0.44
161 0.43
162 0.42
163 0.38
164 0.34
165 0.33
166 0.33
167 0.37
168 0.35
169 0.35
170 0.32
171 0.33
172 0.39
173 0.33
174 0.34
175 0.32
176 0.36
177 0.4
178 0.45
179 0.49
180 0.47
181 0.55
182 0.61
183 0.58
184 0.62
185 0.62
186 0.58
187 0.51
188 0.54
189 0.5
190 0.48
191 0.49
192 0.44
193 0.45
194 0.44
195 0.43
196 0.37
197 0.34
198 0.28
199 0.29
200 0.28
201 0.24
202 0.21
203 0.22
204 0.23