Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R5U2

Protein Details
Accession A0A372R5U2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-132LSLKHESKMGGKKKQQKKKKKKKNKNKHWWKBasic
NLS Segment(s)
PositionSequence
108-132SKMGGKKKQQKKKKKKKNKNKHWWK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 4
Family & Domain DBs
Amino Acid Sequences MLYNNKDVIYRITDYRIVLACNNYCFWLEVPDGDIYLWSHMVGSMVRGGANMEEALTNYLFNRENLRYVVEYSLELIPLDAYEEEAEEWANSPEACIDVTKLSLKHESKMGGKKKQQKKKKKKKNKNKHWWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.27
4 0.24
5 0.23
6 0.26
7 0.25
8 0.25
9 0.25
10 0.22
11 0.21
12 0.21
13 0.19
14 0.17
15 0.15
16 0.13
17 0.15
18 0.14
19 0.13
20 0.12
21 0.12
22 0.09
23 0.09
24 0.09
25 0.06
26 0.06
27 0.06
28 0.07
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.04
41 0.05
42 0.06
43 0.06
44 0.06
45 0.05
46 0.08
47 0.08
48 0.09
49 0.13
50 0.12
51 0.14
52 0.14
53 0.16
54 0.14
55 0.15
56 0.15
57 0.11
58 0.1
59 0.1
60 0.1
61 0.08
62 0.08
63 0.07
64 0.06
65 0.05
66 0.06
67 0.04
68 0.04
69 0.04
70 0.05
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.05
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.06
84 0.07
85 0.07
86 0.09
87 0.12
88 0.12
89 0.15
90 0.23
91 0.24
92 0.25
93 0.28
94 0.31
95 0.35
96 0.45
97 0.5
98 0.52
99 0.59
100 0.68
101 0.75
102 0.81
103 0.85
104 0.87
105 0.9
106 0.91
107 0.94
108 0.95
109 0.96
110 0.97
111 0.98
112 0.98