Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q437

Protein Details
Accession A0A372Q437   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-79LDNYHSQYKKLKKKVKRLEERVKWLDDHydrophilic
NLS Segment(s)
PositionSequence
61-69KKLKKKVKR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MLTDQNHSSDSTSTEQKVIRYTKILAQAFELDKQNAEVYTALSGENRALAKRLDNYHSQYKKLKKKVKRLEERVKWLDDNVDELLAMGHCNCSKESINTSSESSSSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.27
4 0.33
5 0.33
6 0.31
7 0.3
8 0.31
9 0.32
10 0.39
11 0.39
12 0.32
13 0.3
14 0.32
15 0.31
16 0.32
17 0.29
18 0.2
19 0.19
20 0.2
21 0.18
22 0.13
23 0.13
24 0.09
25 0.08
26 0.08
27 0.08
28 0.07
29 0.07
30 0.07
31 0.06
32 0.08
33 0.08
34 0.07
35 0.08
36 0.09
37 0.1
38 0.14
39 0.17
40 0.17
41 0.2
42 0.25
43 0.34
44 0.35
45 0.37
46 0.4
47 0.47
48 0.54
49 0.6
50 0.65
51 0.64
52 0.73
53 0.8
54 0.84
55 0.86
56 0.87
57 0.88
58 0.87
59 0.88
60 0.81
61 0.74
62 0.64
63 0.53
64 0.46
65 0.35
66 0.3
67 0.21
68 0.16
69 0.13
70 0.12
71 0.12
72 0.08
73 0.08
74 0.05
75 0.08
76 0.09
77 0.11
78 0.11
79 0.15
80 0.17
81 0.22
82 0.27
83 0.29
84 0.31
85 0.32
86 0.34
87 0.31