Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RST0

Protein Details
Accession A0A372RST0   
Localization Confidence Medium
Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
61-90KCIDKSRKPNGNSKRFKKKKVVESNDEINEHydrophilic
NLS Segment(s)
PositionSequence
66-80SRKPNGNSKRFKKKK
Subcellular Location(s) nucl 18, cyto_nucl 14.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MEYNDSETSNTESSSFNSEYEENETSKKIAELKQEEFIRLLVAEKLYPLWPTTESLSEINKCIDKSRKPNGNSKRFKKKKVVESNDEINEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.21
3 0.17
4 0.19
5 0.19
6 0.19
7 0.24
8 0.24
9 0.19
10 0.2
11 0.21
12 0.18
13 0.18
14 0.18
15 0.16
16 0.18
17 0.25
18 0.29
19 0.31
20 0.38
21 0.38
22 0.37
23 0.33
24 0.3
25 0.22
26 0.16
27 0.14
28 0.08
29 0.07
30 0.07
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.07
37 0.08
38 0.09
39 0.11
40 0.11
41 0.13
42 0.14
43 0.17
44 0.16
45 0.17
46 0.17
47 0.18
48 0.17
49 0.21
50 0.27
51 0.32
52 0.39
53 0.48
54 0.55
55 0.57
56 0.67
57 0.72
58 0.76
59 0.78
60 0.8
61 0.81
62 0.82
63 0.86
64 0.87
65 0.86
66 0.86
67 0.87
68 0.87
69 0.84
70 0.82
71 0.83
72 0.79