Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QZ10

Protein Details
Accession A0A372QZ10    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MRGKEKNERKKRKEKGRLAMAWVBasic
NLS Segment(s)
PositionSequence
3-17GKEKNERKKRKEKGR
Subcellular Location(s) mito 22, pero 2, cyto 1, plas 1, extr 1
Family & Domain DBs
Amino Acid Sequences MRGKEKNERKKRKEKGRLAMAWVFLAKALLVFGNAWVKAAMVARSNGICNWGISFSEFSDVMSLRFSGSGKVVVSLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.91
4 0.84
5 0.8
6 0.72
7 0.62
8 0.51
9 0.41
10 0.3
11 0.2
12 0.16
13 0.09
14 0.05
15 0.05
16 0.04
17 0.04
18 0.04
19 0.05
20 0.07
21 0.07
22 0.07
23 0.07
24 0.07
25 0.08
26 0.09
27 0.08
28 0.07
29 0.08
30 0.09
31 0.09
32 0.1
33 0.09
34 0.1
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.1
41 0.11
42 0.09
43 0.11
44 0.11
45 0.1
46 0.12
47 0.12
48 0.11
49 0.11
50 0.11
51 0.09
52 0.11
53 0.11
54 0.1
55 0.12
56 0.14
57 0.13