Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QCS1

Protein Details
Accession A0A372QCS1    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-135EDDKPRNKKRKTEKAPLTKPTTBasic
183-207GVKGRPTLEKCKKVKKNRELEAELRBasic
NLS Segment(s)
PositionSequence
117-146KPRNKKRKTEKAPLTKPTTEKNEKRIKALK
171-177KIKKLKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037647  HIRIP3  
Amino Acid Sequences MRVKEEVDKEEQSRRKIEPVEDGGVVMALENKVLAQDSDMIGSKSGDDVESDNTIKEDDDKVLKRTSEPEEDGDNTESVDEAKQELSGLKVELMSTKRTLVKYEDDDTDLSSLEDDKPRNKKRKTEKAPLTKPTTEKNEKRIKALKASINKCGVRKNWSKELADCDTDSKKIKKLKKILEDLGVKGRPTLEKCKKVKKNRELEAELRAMDVDNIISDDVKESRKARASRGIFNPVRRKASRVTQSSPEYDDSSSKDIQSDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.51
3 0.51
4 0.51
5 0.5
6 0.5
7 0.48
8 0.43
9 0.4
10 0.32
11 0.27
12 0.23
13 0.14
14 0.1
15 0.06
16 0.06
17 0.06
18 0.06
19 0.06
20 0.07
21 0.07
22 0.06
23 0.09
24 0.09
25 0.12
26 0.13
27 0.13
28 0.13
29 0.13
30 0.12
31 0.1
32 0.1
33 0.08
34 0.08
35 0.09
36 0.11
37 0.14
38 0.14
39 0.14
40 0.14
41 0.14
42 0.13
43 0.14
44 0.13
45 0.13
46 0.2
47 0.22
48 0.25
49 0.29
50 0.29
51 0.28
52 0.32
53 0.34
54 0.33
55 0.33
56 0.32
57 0.32
58 0.33
59 0.34
60 0.31
61 0.25
62 0.18
63 0.16
64 0.14
65 0.11
66 0.09
67 0.07
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.11
80 0.12
81 0.13
82 0.13
83 0.16
84 0.2
85 0.2
86 0.22
87 0.21
88 0.25
89 0.27
90 0.29
91 0.27
92 0.25
93 0.25
94 0.23
95 0.2
96 0.15
97 0.11
98 0.08
99 0.08
100 0.08
101 0.11
102 0.12
103 0.18
104 0.28
105 0.37
106 0.46
107 0.5
108 0.57
109 0.65
110 0.75
111 0.77
112 0.78
113 0.8
114 0.81
115 0.84
116 0.81
117 0.77
118 0.69
119 0.62
120 0.57
121 0.55
122 0.53
123 0.5
124 0.52
125 0.55
126 0.53
127 0.57
128 0.59
129 0.53
130 0.5
131 0.53
132 0.5
133 0.49
134 0.51
135 0.5
136 0.5
137 0.49
138 0.45
139 0.44
140 0.41
141 0.4
142 0.45
143 0.46
144 0.48
145 0.51
146 0.5
147 0.47
148 0.51
149 0.46
150 0.4
151 0.34
152 0.29
153 0.26
154 0.27
155 0.29
156 0.25
157 0.28
158 0.34
159 0.4
160 0.46
161 0.54
162 0.61
163 0.65
164 0.7
165 0.68
166 0.68
167 0.64
168 0.57
169 0.55
170 0.48
171 0.38
172 0.31
173 0.29
174 0.25
175 0.27
176 0.36
177 0.38
178 0.46
179 0.53
180 0.64
181 0.72
182 0.79
183 0.86
184 0.85
185 0.85
186 0.84
187 0.86
188 0.82
189 0.75
190 0.7
191 0.61
192 0.51
193 0.4
194 0.32
195 0.23
196 0.16
197 0.14
198 0.08
199 0.05
200 0.06
201 0.06
202 0.06
203 0.06
204 0.08
205 0.1
206 0.13
207 0.17
208 0.18
209 0.25
210 0.33
211 0.36
212 0.4
213 0.47
214 0.5
215 0.54
216 0.59
217 0.63
218 0.6
219 0.67
220 0.71
221 0.68
222 0.71
223 0.64
224 0.62
225 0.58
226 0.63
227 0.63
228 0.61
229 0.59
230 0.59
231 0.63
232 0.62
233 0.59
234 0.52
235 0.45
236 0.39
237 0.37
238 0.33
239 0.32
240 0.3
241 0.27
242 0.26