Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RP01

Protein Details
Accession A0A372RP01    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-34HHSFLSPKKSIIKRKKRSANCFLLFRHydrophilic
NLS Segment(s)
PositionSequence
16-25KKSIIKRKKR
Subcellular Location(s) mito_nucl 13.666, mito 13, nucl 12, cyto_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MINNLYVVHHSFLSPKKSIIKRKKRSANCFLLFRQEMMKERPYKMKMSNYSKRVSEMWQNLSEDEKIEWKRRYELNRESVEPVNET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.36
4 0.44
5 0.55
6 0.61
7 0.66
8 0.71
9 0.8
10 0.87
11 0.88
12 0.89
13 0.88
14 0.87
15 0.81
16 0.76
17 0.66
18 0.63
19 0.53
20 0.44
21 0.37
22 0.29
23 0.27
24 0.26
25 0.31
26 0.27
27 0.29
28 0.35
29 0.35
30 0.36
31 0.38
32 0.43
33 0.45
34 0.51
35 0.57
36 0.54
37 0.55
38 0.52
39 0.49
40 0.43
41 0.37
42 0.36
43 0.34
44 0.34
45 0.35
46 0.35
47 0.33
48 0.33
49 0.31
50 0.23
51 0.18
52 0.21
53 0.22
54 0.29
55 0.33
56 0.34
57 0.39
58 0.45
59 0.52
60 0.54
61 0.59
62 0.61
63 0.62
64 0.62
65 0.61
66 0.58