Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RJI3

Protein Details
Accession A0A372RJI3   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
164-186QSVQIKYYKKLKIEKSKKSNITKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, cysk 10, nucl 7.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR037431  REX4_DEDDh_dom  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0008408  F:3'-5' exonuclease activity  
GO:0003676  F:nucleic acid binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF00929  RNase_T  
CDD cd06144  REX4_like  
Amino Acid Sequences IGKYVAIDCEMVGVGPDGIQSALARVTIVNYYGVTILDKYVRPIERVTDFRTEISGITPKLLINSHDFKQVQQEVYNIIKDRIVVGHALQHDFKMLMLDHPRKMIRDTSLYEPFRKIAKGKTPSLKRLASEELGMTIQTGKHSSVEDAQACMMLYRKHKEQWEQSVQIKYYKKLKIEKSKKSNITK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.05
5 0.05
6 0.06
7 0.06
8 0.06
9 0.07
10 0.07
11 0.07
12 0.06
13 0.08
14 0.08
15 0.09
16 0.09
17 0.08
18 0.09
19 0.09
20 0.1
21 0.09
22 0.09
23 0.09
24 0.12
25 0.12
26 0.14
27 0.2
28 0.21
29 0.22
30 0.23
31 0.26
32 0.29
33 0.32
34 0.34
35 0.32
36 0.32
37 0.31
38 0.31
39 0.27
40 0.21
41 0.2
42 0.2
43 0.14
44 0.14
45 0.14
46 0.13
47 0.14
48 0.15
49 0.14
50 0.15
51 0.19
52 0.2
53 0.26
54 0.26
55 0.25
56 0.31
57 0.32
58 0.28
59 0.25
60 0.25
61 0.21
62 0.23
63 0.25
64 0.18
65 0.15
66 0.14
67 0.13
68 0.13
69 0.1
70 0.09
71 0.07
72 0.07
73 0.1
74 0.1
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.09
81 0.07
82 0.06
83 0.08
84 0.14
85 0.18
86 0.18
87 0.21
88 0.22
89 0.22
90 0.24
91 0.24
92 0.2
93 0.21
94 0.23
95 0.26
96 0.34
97 0.35
98 0.35
99 0.33
100 0.32
101 0.29
102 0.28
103 0.24
104 0.22
105 0.3
106 0.34
107 0.4
108 0.48
109 0.53
110 0.57
111 0.62
112 0.57
113 0.49
114 0.47
115 0.45
116 0.36
117 0.31
118 0.25
119 0.2
120 0.17
121 0.16
122 0.12
123 0.09
124 0.08
125 0.09
126 0.1
127 0.09
128 0.1
129 0.11
130 0.13
131 0.15
132 0.2
133 0.19
134 0.19
135 0.18
136 0.18
137 0.17
138 0.16
139 0.15
140 0.14
141 0.19
142 0.24
143 0.29
144 0.34
145 0.4
146 0.48
147 0.54
148 0.61
149 0.64
150 0.65
151 0.66
152 0.67
153 0.63
154 0.62
155 0.57
156 0.52
157 0.52
158 0.52
159 0.53
160 0.55
161 0.64
162 0.68
163 0.75
164 0.8
165 0.82
166 0.86