Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372R1L6

Protein Details
Accession A0A372R1L6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSNKTSKKAKGREFKPREPYTHRBasic
NLS Segment(s)
PositionSequence
7-17KKAKGREFKPR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036890  HATPase_C_sf  
Amino Acid Sequences MSNKTSKKAKGREFKPREPYTHRLRKILEDYPDGSQVLREILQNSDDAKSTEQIFILDHNTYPKDNLFEPDLDNYKRTDLKLDRYQGPALLAKNNTIFEERDFQSLLKLADSEKRDQYDKIGVMGVGFNSIYHITDSPSFITGDKYVILDPHEWYFNGGVEFDFVDEKLYDEYPNQFAPFRIPCDESFEGTIFRYPLRTDDDSIDSDISKKIYKPDEILAMFQKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.83
4 0.81
5 0.79
6 0.78
7 0.78
8 0.79
9 0.74
10 0.7
11 0.66
12 0.66
13 0.64
14 0.63
15 0.57
16 0.51
17 0.49
18 0.45
19 0.44
20 0.36
21 0.29
22 0.23
23 0.18
24 0.15
25 0.13
26 0.12
27 0.11
28 0.13
29 0.13
30 0.14
31 0.15
32 0.15
33 0.14
34 0.14
35 0.14
36 0.15
37 0.16
38 0.16
39 0.14
40 0.14
41 0.13
42 0.13
43 0.14
44 0.13
45 0.12
46 0.14
47 0.15
48 0.15
49 0.16
50 0.16
51 0.16
52 0.16
53 0.18
54 0.17
55 0.17
56 0.18
57 0.21
58 0.24
59 0.23
60 0.22
61 0.21
62 0.22
63 0.23
64 0.22
65 0.25
66 0.24
67 0.31
68 0.38
69 0.42
70 0.42
71 0.43
72 0.43
73 0.36
74 0.34
75 0.29
76 0.23
77 0.21
78 0.18
79 0.17
80 0.18
81 0.18
82 0.17
83 0.15
84 0.15
85 0.12
86 0.18
87 0.17
88 0.17
89 0.17
90 0.16
91 0.15
92 0.16
93 0.15
94 0.09
95 0.09
96 0.08
97 0.13
98 0.15
99 0.18
100 0.18
101 0.2
102 0.21
103 0.21
104 0.22
105 0.22
106 0.2
107 0.18
108 0.16
109 0.14
110 0.13
111 0.13
112 0.1
113 0.06
114 0.05
115 0.04
116 0.05
117 0.05
118 0.06
119 0.06
120 0.06
121 0.07
122 0.08
123 0.1
124 0.09
125 0.1
126 0.1
127 0.1
128 0.11
129 0.11
130 0.1
131 0.1
132 0.1
133 0.09
134 0.09
135 0.11
136 0.1
137 0.11
138 0.12
139 0.13
140 0.12
141 0.13
142 0.13
143 0.12
144 0.11
145 0.1
146 0.08
147 0.08
148 0.08
149 0.07
150 0.07
151 0.06
152 0.07
153 0.07
154 0.08
155 0.09
156 0.1
157 0.1
158 0.11
159 0.14
160 0.15
161 0.17
162 0.17
163 0.16
164 0.16
165 0.21
166 0.23
167 0.24
168 0.25
169 0.26
170 0.26
171 0.33
172 0.35
173 0.31
174 0.3
175 0.27
176 0.25
177 0.23
178 0.25
179 0.17
180 0.16
181 0.16
182 0.14
183 0.16
184 0.22
185 0.25
186 0.25
187 0.28
188 0.32
189 0.32
190 0.33
191 0.31
192 0.24
193 0.22
194 0.22
195 0.2
196 0.19
197 0.19
198 0.24
199 0.29
200 0.33
201 0.35
202 0.38
203 0.44
204 0.43
205 0.45