Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372RR72

Protein Details
Accession A0A372RR72    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
12-40VTSINFNRAIHKRRRRRIVNRKYRNAFNIHydrophilic
NLS Segment(s)
PositionSequence
22-33HKRRRRRIVNRK
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MTLKSPRNLNYVTSINFNRAIHKRRRRRIVNRKYRNAFNINTLSRLPLQITNDPFAFSRFELSSAINNWKSLNKLNIAPTPAGLKSQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.34
4 0.32
5 0.34
6 0.37
7 0.43
8 0.48
9 0.57
10 0.65
11 0.7
12 0.81
13 0.84
14 0.87
15 0.91
16 0.92
17 0.92
18 0.92
19 0.93
20 0.88
21 0.82
22 0.77
23 0.7
24 0.6
25 0.54
26 0.51
27 0.41
28 0.37
29 0.32
30 0.27
31 0.22
32 0.22
33 0.17
34 0.13
35 0.15
36 0.18
37 0.2
38 0.2
39 0.2
40 0.21
41 0.2
42 0.18
43 0.17
44 0.12
45 0.14
46 0.12
47 0.13
48 0.13
49 0.14
50 0.16
51 0.17
52 0.24
53 0.22
54 0.22
55 0.22
56 0.24
57 0.25
58 0.28
59 0.29
60 0.26
61 0.29
62 0.35
63 0.38
64 0.39
65 0.36
66 0.32
67 0.32
68 0.29