Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RA19

Protein Details
Accession A0A372RA19    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
24-46RYANAYTMKSHRRRKRDNFLDEAHydrophilic
NLS Segment(s)
PositionSequence
35-39RRRKR
48-63KKSVGEDIRRRNKEKK
Subcellular Location(s) nucl 17, mito 8
Family & Domain DBs
Amino Acid Sequences MTQREIIPLTTTHLTSIWVQTRVRYANAYTMKSHRRRKRDNFLDEAHKKSVGEDIRRRNKEKKLQRESANQDSISDTAYVNIPTVDSKVSNDLKPVNRISENSELSRDKCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.24
4 0.24
5 0.25
6 0.25
7 0.26
8 0.32
9 0.32
10 0.32
11 0.28
12 0.24
13 0.29
14 0.33
15 0.34
16 0.31
17 0.36
18 0.44
19 0.51
20 0.6
21 0.6
22 0.65
23 0.73
24 0.8
25 0.85
26 0.85
27 0.83
28 0.78
29 0.74
30 0.75
31 0.68
32 0.62
33 0.52
34 0.42
35 0.36
36 0.3
37 0.31
38 0.25
39 0.28
40 0.31
41 0.4
42 0.49
43 0.54
44 0.58
45 0.59
46 0.64
47 0.66
48 0.69
49 0.7
50 0.69
51 0.73
52 0.74
53 0.77
54 0.75
55 0.73
56 0.67
57 0.56
58 0.47
59 0.41
60 0.35
61 0.27
62 0.2
63 0.12
64 0.08
65 0.1
66 0.09
67 0.08
68 0.08
69 0.07
70 0.07
71 0.08
72 0.09
73 0.08
74 0.1
75 0.17
76 0.21
77 0.21
78 0.24
79 0.3
80 0.33
81 0.38
82 0.39
83 0.38
84 0.37
85 0.38
86 0.41
87 0.43
88 0.43
89 0.39
90 0.43
91 0.4