Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372Q3P2

Protein Details
Accession A0A372Q3P2   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-94VISGSKVKKTRRKKTKSKPVRVSELPHydrophilic
NLS Segment(s)
PositionSequence
75-88KVKKTRRKKTKSKP
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MINPPLRRLRRHHAISRYEVQASGTIKEEISYIIFSSISDLERAGALENVIPDGAEKPNRSTDPVSXEGVISGSKVKKTRRKKTKSKPVRVSELPAIQTQLALMNSKGLNINDEELNAFYEKEAKRDEKNKAEVNRRLAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.74
4 0.67
5 0.58
6 0.49
7 0.41
8 0.37
9 0.31
10 0.25
11 0.21
12 0.18
13 0.16
14 0.16
15 0.15
16 0.11
17 0.11
18 0.1
19 0.08
20 0.08
21 0.08
22 0.08
23 0.1
24 0.1
25 0.09
26 0.09
27 0.09
28 0.08
29 0.08
30 0.09
31 0.07
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.06
41 0.09
42 0.11
43 0.12
44 0.14
45 0.19
46 0.2
47 0.23
48 0.22
49 0.21
50 0.23
51 0.23
52 0.22
53 0.17
54 0.16
55 0.14
56 0.13
57 0.12
58 0.1
59 0.1
60 0.12
61 0.16
62 0.24
63 0.33
64 0.44
65 0.54
66 0.62
67 0.71
68 0.8
69 0.87
70 0.91
71 0.93
72 0.93
73 0.92
74 0.88
75 0.86
76 0.77
77 0.71
78 0.65
79 0.58
80 0.48
81 0.39
82 0.33
83 0.25
84 0.22
85 0.17
86 0.14
87 0.11
88 0.1
89 0.09
90 0.12
91 0.12
92 0.13
93 0.16
94 0.13
95 0.14
96 0.15
97 0.17
98 0.13
99 0.14
100 0.14
101 0.12
102 0.14
103 0.12
104 0.11
105 0.09
106 0.16
107 0.16
108 0.2
109 0.26
110 0.28
111 0.37
112 0.45
113 0.54
114 0.55
115 0.63
116 0.68
117 0.71
118 0.76
119 0.75