Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QY27

Protein Details
Accession A0A372QY27    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTTKRRNHGRNKHGRGHVKPVRBasic
84-116VRVRSREGRRNRAPPPRVRYNKDGKKINPNVQQHydrophilic
NLS Segment(s)
PositionSequence
6-15RNHGRNKHGR
87-108RSREGRRNRAPPPRVRYNKDGK
Subcellular Location(s) mito 12.5, mito_nucl 12, nucl 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTTKRRNHGRNKHGRGHVKPVRCSNCARCVPKDKAIKRFTVRNMVESAAIRDITDASVYQEYALPKLYIKLHYCVSCAIHSHVVRVRSREGRRNRAPPPRVRYNKDGKKINPNVQQKATT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.82
3 0.82
4 0.79
5 0.75
6 0.74
7 0.74
8 0.7
9 0.64
10 0.65
11 0.61
12 0.63
13 0.64
14 0.62
15 0.59
16 0.61
17 0.64
18 0.65
19 0.69
20 0.65
21 0.66
22 0.65
23 0.66
24 0.62
25 0.63
26 0.59
27 0.59
28 0.53
29 0.46
30 0.44
31 0.37
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.09
50 0.1
51 0.08
52 0.08
53 0.11
54 0.12
55 0.15
56 0.17
57 0.19
58 0.21
59 0.22
60 0.22
61 0.22
62 0.22
63 0.18
64 0.18
65 0.18
66 0.21
67 0.21
68 0.24
69 0.26
70 0.29
71 0.3
72 0.31
73 0.35
74 0.37
75 0.44
76 0.49
77 0.56
78 0.61
79 0.68
80 0.73
81 0.76
82 0.78
83 0.8
84 0.8
85 0.79
86 0.8
87 0.8
88 0.79
89 0.78
90 0.79
91 0.8
92 0.8
93 0.81
94 0.76
95 0.78
96 0.8
97 0.81
98 0.8
99 0.79
100 0.78