Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372R4J8

Protein Details
Accession A0A372R4J8    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
315-334VGFLLYRWNKNRQKSDNNNIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, cyto 10.5, nucl 8.5, mito 4, plas 1, extr 1, golg 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR011043  Gal_Oxase/kelch_b-propeller  
IPR015915  Kelch-typ_b-propeller  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTPYKKERSRHTATLINDKLYILGGDVGRDFFYLDVSVPFNTQKLLWNELSNINNVPSHYAAASVNSGENNDRLLLYGGVVINNPTVTDFVYIFNPQSNSWSIPKITENIPPKISGDTPLKKGGDSGKSLALNQVYLYDTINDNWSTKTTSGIVPSGRDGFSAVLGSDGQRVIIYGGVPAVNQKFTPEDSFYELNVINFEWRIPKISGKIPKSRAYHRANVIGKYMVITFGEGYDRFTESDILLLDISNVDEYIWTYEFYPPPPPQSSTKSGKVPTSPSSPSAMPPSIIVQSQSAPSMTGAIIGSLIGGATLSSVGFLLYRWNKNRQKSDNNNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.63
3 0.56
4 0.48
5 0.4
6 0.34
7 0.28
8 0.23
9 0.13
10 0.13
11 0.11
12 0.12
13 0.13
14 0.13
15 0.13
16 0.13
17 0.12
18 0.08
19 0.09
20 0.09
21 0.09
22 0.1
23 0.11
24 0.12
25 0.13
26 0.14
27 0.13
28 0.14
29 0.14
30 0.19
31 0.21
32 0.26
33 0.27
34 0.28
35 0.3
36 0.35
37 0.36
38 0.31
39 0.28
40 0.24
41 0.23
42 0.22
43 0.22
44 0.17
45 0.16
46 0.14
47 0.15
48 0.13
49 0.13
50 0.14
51 0.12
52 0.12
53 0.11
54 0.12
55 0.12
56 0.12
57 0.11
58 0.11
59 0.1
60 0.1
61 0.11
62 0.1
63 0.09
64 0.11
65 0.1
66 0.1
67 0.1
68 0.1
69 0.09
70 0.09
71 0.08
72 0.06
73 0.06
74 0.07
75 0.08
76 0.08
77 0.09
78 0.11
79 0.12
80 0.12
81 0.15
82 0.15
83 0.14
84 0.16
85 0.17
86 0.18
87 0.19
88 0.22
89 0.19
90 0.2
91 0.22
92 0.22
93 0.21
94 0.26
95 0.29
96 0.3
97 0.31
98 0.29
99 0.29
100 0.28
101 0.26
102 0.24
103 0.27
104 0.27
105 0.29
106 0.34
107 0.33
108 0.31
109 0.33
110 0.34
111 0.29
112 0.28
113 0.26
114 0.25
115 0.25
116 0.26
117 0.26
118 0.2
119 0.16
120 0.13
121 0.13
122 0.09
123 0.09
124 0.09
125 0.08
126 0.08
127 0.09
128 0.11
129 0.1
130 0.1
131 0.1
132 0.11
133 0.12
134 0.11
135 0.12
136 0.11
137 0.12
138 0.13
139 0.15
140 0.14
141 0.13
142 0.14
143 0.15
144 0.13
145 0.12
146 0.11
147 0.09
148 0.09
149 0.08
150 0.07
151 0.05
152 0.05
153 0.05
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.05
162 0.04
163 0.04
164 0.04
165 0.04
166 0.06
167 0.07
168 0.07
169 0.07
170 0.07
171 0.08
172 0.1
173 0.12
174 0.12
175 0.13
176 0.17
177 0.18
178 0.17
179 0.18
180 0.17
181 0.15
182 0.13
183 0.12
184 0.08
185 0.08
186 0.08
187 0.08
188 0.08
189 0.12
190 0.12
191 0.15
192 0.18
193 0.25
194 0.33
195 0.36
196 0.44
197 0.46
198 0.53
199 0.55
200 0.58
201 0.61
202 0.58
203 0.6
204 0.55
205 0.59
206 0.55
207 0.52
208 0.47
209 0.38
210 0.32
211 0.25
212 0.21
213 0.13
214 0.1
215 0.09
216 0.07
217 0.07
218 0.09
219 0.08
220 0.1
221 0.11
222 0.12
223 0.12
224 0.12
225 0.13
226 0.1
227 0.12
228 0.1
229 0.09
230 0.08
231 0.08
232 0.07
233 0.06
234 0.07
235 0.05
236 0.05
237 0.04
238 0.04
239 0.05
240 0.08
241 0.08
242 0.08
243 0.1
244 0.14
245 0.16
246 0.18
247 0.24
248 0.23
249 0.28
250 0.31
251 0.33
252 0.34
253 0.39
254 0.45
255 0.45
256 0.5
257 0.51
258 0.51
259 0.52
260 0.51
261 0.5
262 0.47
263 0.47
264 0.43
265 0.39
266 0.39
267 0.35
268 0.34
269 0.35
270 0.31
271 0.25
272 0.23
273 0.24
274 0.22
275 0.22
276 0.2
277 0.15
278 0.16
279 0.17
280 0.17
281 0.14
282 0.13
283 0.12
284 0.13
285 0.11
286 0.12
287 0.1
288 0.09
289 0.09
290 0.08
291 0.07
292 0.05
293 0.05
294 0.03
295 0.03
296 0.03
297 0.03
298 0.03
299 0.03
300 0.04
301 0.04
302 0.04
303 0.04
304 0.05
305 0.14
306 0.22
307 0.31
308 0.36
309 0.47
310 0.55
311 0.65
312 0.76
313 0.76
314 0.79