Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RRQ4

Protein Details
Accession A0A372RRQ4   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-78EYGYYDKKKDHKDDKKDDKKDYYKRSABasic
NLS Segment(s)
Subcellular Location(s) cyto 8, nucl 7, extr 6, mito 2, E.R. 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MKFTTLVCLTALGVSALNVNAAPISDVELNNKRDEASTYYYDDDKKDKYDDEYGYYDKKKDHKDDKKDDKKDYYKRSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.05
10 0.04
11 0.07
12 0.08
13 0.09
14 0.14
15 0.2
16 0.22
17 0.22
18 0.22
19 0.2
20 0.19
21 0.21
22 0.19
23 0.18
24 0.18
25 0.19
26 0.2
27 0.21
28 0.22
29 0.21
30 0.2
31 0.17
32 0.17
33 0.17
34 0.17
35 0.19
36 0.24
37 0.24
38 0.25
39 0.27
40 0.28
41 0.31
42 0.32
43 0.31
44 0.3
45 0.36
46 0.4
47 0.46
48 0.55
49 0.6
50 0.69
51 0.78
52 0.85
53 0.89
54 0.89
55 0.87
56 0.86
57 0.86
58 0.86