Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372QET3

Protein Details
Accession A0A372QET3   
Localization Confidence Low
Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
87-112APALVKKQGRSRTRRQKNNENDKPVEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 10.5, nucl 7.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
Amino Acid Sequences MDSLFPINIYDKFLKQDNKLLGSDDNNIRVVVGLDFGTTYSGFAYCHVSDEVNICSNDVWNGNVGQLKTNTVLQYDDEYNNVKLWGAPALVKKQGRSRTRRQKNNENDKPVELFKLHLGDLLEELKPKLPVDYKKAITDYLREIGKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.42
4 0.42
5 0.43
6 0.42
7 0.41
8 0.37
9 0.34
10 0.38
11 0.33
12 0.3
13 0.27
14 0.26
15 0.23
16 0.2
17 0.19
18 0.12
19 0.1
20 0.07
21 0.06
22 0.06
23 0.06
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.07
31 0.11
32 0.1
33 0.12
34 0.13
35 0.12
36 0.13
37 0.14
38 0.15
39 0.14
40 0.14
41 0.12
42 0.11
43 0.11
44 0.12
45 0.1
46 0.09
47 0.07
48 0.07
49 0.08
50 0.1
51 0.1
52 0.11
53 0.11
54 0.12
55 0.12
56 0.13
57 0.12
58 0.11
59 0.11
60 0.1
61 0.12
62 0.13
63 0.12
64 0.11
65 0.13
66 0.13
67 0.13
68 0.12
69 0.1
70 0.08
71 0.08
72 0.08
73 0.07
74 0.09
75 0.11
76 0.14
77 0.2
78 0.21
79 0.23
80 0.29
81 0.38
82 0.44
83 0.49
84 0.57
85 0.63
86 0.72
87 0.8
88 0.82
89 0.83
90 0.86
91 0.9
92 0.88
93 0.85
94 0.77
95 0.69
96 0.64
97 0.54
98 0.46
99 0.35
100 0.27
101 0.22
102 0.21
103 0.18
104 0.17
105 0.17
106 0.14
107 0.16
108 0.16
109 0.14
110 0.13
111 0.14
112 0.14
113 0.15
114 0.15
115 0.18
116 0.23
117 0.29
118 0.36
119 0.44
120 0.45
121 0.49
122 0.5
123 0.5
124 0.45
125 0.43
126 0.41
127 0.38