Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RNS4

Protein Details
Accession A0A372RNS4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
74-99PWGVLAKSGKTRKKPNKWVIKPRQRRHydrophilic
NLS Segment(s)
PositionSequence
79-99AKSGKTRKKPNKWVIKPRQRR
Subcellular Location(s) mito 20, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002171  Ribosomal_L2  
IPR022669  Ribosomal_L2_C  
IPR014726  Ribosomal_L2_dom3  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF03947  Ribosomal_L2_C  
Amino Acid Sequences KIKSCEVRLIHVDCCATIRTISNPDHQHATLGKAGRSRWLGVRSTVRGVAMNAVDHPHGVGSGKSKGNRYPVSPWGVLAKSGKTRKKPNKWVIKPRQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.22
3 0.17
4 0.14
5 0.15
6 0.15
7 0.21
8 0.23
9 0.29
10 0.31
11 0.33
12 0.36
13 0.34
14 0.33
15 0.28
16 0.28
17 0.24
18 0.23
19 0.22
20 0.21
21 0.21
22 0.23
23 0.24
24 0.23
25 0.24
26 0.25
27 0.25
28 0.26
29 0.31
30 0.28
31 0.28
32 0.27
33 0.22
34 0.19
35 0.18
36 0.16
37 0.11
38 0.09
39 0.08
40 0.08
41 0.08
42 0.07
43 0.07
44 0.05
45 0.05
46 0.05
47 0.06
48 0.08
49 0.13
50 0.17
51 0.19
52 0.22
53 0.25
54 0.33
55 0.35
56 0.36
57 0.36
58 0.38
59 0.42
60 0.4
61 0.37
62 0.34
63 0.32
64 0.31
65 0.27
66 0.26
67 0.29
68 0.38
69 0.45
70 0.48
71 0.59
72 0.68
73 0.77
74 0.84
75 0.85
76 0.88
77 0.91
78 0.94
79 0.94