Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A372QUI4

Protein Details
Accession A0A372QUI4    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
164-184KYLAEREEKKAKWKNKKWWRDBasic
NLS Segment(s)
PositionSequence
171-183EKKAKWKNKKWWR
Subcellular Location(s) nucl 12, mito 6, cyto 4, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009792  TMEM242  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF07096  DUF1358  
Amino Acid Sequences MVQNTNSSTQIHHDTTSITTQKIQLSDIPTNSHNLLLGLSALTFFTSLTGSALYARRKASEYLRDSTTLSPSTTSSSQLNSAFRFSLQAFAVGSILCVSASGLIAFGVGKMLGVRNLYEFHKKMEELIPTYTPGLRKSVRNSQDIDQQQEWKIFDQEWIEERNKYLAEREEKKAKWKNKKWWRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.32
4 0.29
5 0.24
6 0.24
7 0.26
8 0.29
9 0.28
10 0.27
11 0.23
12 0.27
13 0.31
14 0.31
15 0.31
16 0.28
17 0.31
18 0.3
19 0.26
20 0.2
21 0.15
22 0.13
23 0.1
24 0.1
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.09
39 0.13
40 0.15
41 0.18
42 0.19
43 0.2
44 0.22
45 0.25
46 0.28
47 0.33
48 0.35
49 0.36
50 0.37
51 0.36
52 0.36
53 0.34
54 0.31
55 0.23
56 0.18
57 0.15
58 0.14
59 0.17
60 0.16
61 0.16
62 0.14
63 0.14
64 0.16
65 0.18
66 0.19
67 0.17
68 0.17
69 0.15
70 0.14
71 0.15
72 0.13
73 0.13
74 0.11
75 0.11
76 0.1
77 0.1
78 0.1
79 0.08
80 0.08
81 0.05
82 0.05
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.05
100 0.05
101 0.06
102 0.07
103 0.09
104 0.12
105 0.18
106 0.19
107 0.2
108 0.22
109 0.22
110 0.23
111 0.26
112 0.27
113 0.23
114 0.25
115 0.23
116 0.22
117 0.23
118 0.22
119 0.2
120 0.17
121 0.21
122 0.21
123 0.25
124 0.3
125 0.39
126 0.43
127 0.45
128 0.47
129 0.45
130 0.51
131 0.5
132 0.5
133 0.43
134 0.42
135 0.4
136 0.4
137 0.38
138 0.31
139 0.29
140 0.22
141 0.23
142 0.21
143 0.22
144 0.21
145 0.25
146 0.25
147 0.25
148 0.26
149 0.26
150 0.25
151 0.23
152 0.26
153 0.29
154 0.36
155 0.41
156 0.47
157 0.53
158 0.55
159 0.64
160 0.69
161 0.71
162 0.73
163 0.77
164 0.81