Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A372RSV1

Protein Details
Accession A0A372RSV1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSSTKSKIDKKCKIENKVSSTPTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MSSTKSKIDKKCKIENKVSSTPTINKNNEKLMVDKNNKNKKVIENSKSEIDDIFASVKNKKVSTDPQLQELSTVPSSSSLSSSTIKQKVEEFVFKVPAIPDKSQATKRKLKLNDDNGFSDTRGTKSHGLPIFDIKELNVGNGEDTPLCPFDCDCCF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.8
5 0.74
6 0.67
7 0.63
8 0.6
9 0.58
10 0.59
11 0.56
12 0.54
13 0.55
14 0.56
15 0.55
16 0.5
17 0.45
18 0.44
19 0.48
20 0.49
21 0.52
22 0.58
23 0.64
24 0.65
25 0.65
26 0.61
27 0.59
28 0.62
29 0.65
30 0.6
31 0.57
32 0.58
33 0.59
34 0.55
35 0.47
36 0.36
37 0.27
38 0.22
39 0.16
40 0.14
41 0.11
42 0.12
43 0.13
44 0.18
45 0.19
46 0.19
47 0.2
48 0.22
49 0.26
50 0.31
51 0.4
52 0.36
53 0.39
54 0.39
55 0.38
56 0.34
57 0.29
58 0.25
59 0.15
60 0.14
61 0.09
62 0.09
63 0.1
64 0.09
65 0.09
66 0.07
67 0.09
68 0.1
69 0.13
70 0.18
71 0.21
72 0.22
73 0.22
74 0.22
75 0.24
76 0.26
77 0.27
78 0.22
79 0.2
80 0.22
81 0.21
82 0.21
83 0.17
84 0.2
85 0.22
86 0.2
87 0.22
88 0.23
89 0.28
90 0.36
91 0.43
92 0.45
93 0.49
94 0.53
95 0.59
96 0.62
97 0.66
98 0.68
99 0.7
100 0.69
101 0.64
102 0.62
103 0.55
104 0.5
105 0.41
106 0.34
107 0.26
108 0.21
109 0.19
110 0.2
111 0.23
112 0.23
113 0.32
114 0.32
115 0.33
116 0.32
117 0.37
118 0.36
119 0.32
120 0.31
121 0.22
122 0.24
123 0.21
124 0.21
125 0.16
126 0.13
127 0.14
128 0.14
129 0.15
130 0.11
131 0.12
132 0.14
133 0.13
134 0.13
135 0.13
136 0.13